Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.64
PubTator Score 10.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.78178960367348E-6
glioblastoma 5572 1.55712084424602E-5
medulloblastoma, large-cell 6234 2.74559496986572E-5
tuberculosis and treatment for 6 months 686 1.64438348019856E-4
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 3.266 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.079 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.200 0.000
tuberculosis and treatment for 6 months -1.200 0.000

Synonym

Gene

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
24367676 Benzbromarone metabolites and derivatives function as EYA3 inhibitory anti-angiogenic agents.
22723308 These studies identify EYA3 as a novel mediator of chemoresistance in Ewing sarcoma and define the molecular mechanisms of both EYA3 overexpression and of EYA3-mediated chemoresistance
19351884 EYA2 and EYA3 displayed specificity for Tyr-142 of H2A.X

AA Sequence

MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQ      1 - 70
MYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFGALWPGMKPESGLIQTPSPS     71 - 140
QHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQA    141 - 210
CYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRK    211 - 280
NMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEV    281 - 350
ADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYR    351 - 420
KVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPAL    421 - 490
AKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQHNMPFWRITNHGD    491 - 560
LVSLHQALELDFL                                                             561 - 573
//

Text Mined References (23)

PMID Year Title
24367676 2013 Structure-activity relationships of benzbromarone metabolites and derivatives as EYA inhibitory anti-angiogenic agents.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22971774 2013 The Eyes Absent proteins in development and disease.
22723308 2012 EWS/FLI1 regulates EYA3 in Ewing sarcoma via modulation of miRNA-708, resulting in increased cell survival and chemoresistance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19901965 2010 Inhibition of Eyes Absent Homolog 4 expression induces malignant peripheral nerve sheath tumor necrosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19351884 2009 Dephosphorylation of the C-terminal tyrosyl residue of the DNA damage-related histone H2A.X is mediated by the protein phosphatase eyes absent.
19234442 2009 Tyrosine dephosphorylation of H2AX modulates apoptosis and survival decisions.
More...