Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.66
PubTator Score 10.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.8e-06
glioblastoma 5792 1.6e-05
medulloblastoma, large-cell 6241 2.7e-05
tuberculosis and treatment for 6 months 409 1.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 3.18 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.200 1.6e-05
medulloblastoma, large-cell 1.200 2.7e-05
osteosarcoma -1.079 2.8e-06
tuberculosis and treatment for 6 months -1.200 1.6e-04

Gene RIF (3)

AA Sequence

MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQ      1 - 70
MYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFGALWPGMKPESGLIQTPSPS     71 - 140
QHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQA    141 - 210
CYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRK    211 - 280
NMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEV    281 - 350
ADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYR    351 - 420
KVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPAL    421 - 490
AKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQHNMPFWRITNHGD    491 - 560
LVSLHQALELDFL                                                             561 - 573
//

Text Mined References (23)

PMID Year Title