Property Summary

NCBI Gene PubMed Count 15
Grant Count 8
R01 Count 4
Funding $533,664.45
PubMed Score 7.64
PubTator Score 10.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.079 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.200 0.000
tuberculosis and treatment for 6 months -1.200 0.000

Gene RIF (3)

PMID Text
24367676 Benzbromarone metabolites and derivatives function as EYA3 inhibitory anti-angiogenic agents.
22723308 These studies identify EYA3 as a novel mediator of chemoresistance in Ewing sarcoma and define the molecular mechanisms of both EYA3 overexpression and of EYA3-mediated chemoresistance
19351884 EYA2 and EYA3 displayed specificity for Tyr-142 of H2A.X

AA Sequence

MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQ      1 - 70
MYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFGALWPGMKPESGLIQTPSPS     71 - 140
QHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQA    141 - 210
CYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRK    211 - 280
NMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYAQKYGKDPTVVIGSGLTMEEMIFEV    281 - 350
ADTHLFFNDLEECDQVHVEDVASDDNGQDLSNYSFSTDGFSGSGGSGSHGSSVGVQGGVDWMRKLAFRYR    351 - 420
KVREIYDKHKSNVGGLLSPQRKEALQRLRAEIEVLTDSWLGTALKSLLLIQSRKNCVNVLITTTQLVPAL    421 - 490
AKVLLYGLGEIFPIENIYSATKIGKESCFERIVSRFGKKVTYVVIGDGRDEEIAAKQHNMPFWRITNHGD    491 - 560
LVSLHQALELDFL                                                             561 - 573
//

Text Mined References (23)

PMID Year Title
24367676 2013 Structure-activity relationships of benzbromarone metabolites and derivatives as EYA inhibitory anti-angiogenic agents.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22971774 2013 The Eyes Absent proteins in development and disease.
22723308 2012 EWS/FLI1 regulates EYA3 in Ewing sarcoma via modulation of miRNA-708, resulting in increased cell survival and chemoresistance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19901965 2010 Inhibition of Eyes Absent Homolog 4 expression induces malignant peripheral nerve sheath tumor necrosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19351884 2009 Dephosphorylation of the C-terminal tyrosyl residue of the DNA damage-related histone H2A.X is mediated by the protein phosphatase eyes absent.
19234442 2009 Tyrosine dephosphorylation of H2AX modulates apoptosis and survival decisions.
More...