Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.04
PubTator Score 3.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.100 0.007
osteosarcoma -1.632 0.007
medulloblastoma -1.900 0.000
astrocytoma 1.300 0.033
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -1.500 0.014
tuberculosis 1.200 0.000
ovarian cancer 1.800 0.000

Gene RIF (6)

PMID Text
25496667 Genome-wide shRNA screening identifies GAS2L1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24706950 GAS2L1 and GAS2L2 are differentially involved in mediating the crosstalk between F-actin and microtubules.
20537721 There was no significant difference in the frequency six marker haplotype in the GAS2L1 gene between the cases of schizophreina and controls.
20537721 Observational study of gene-disease association. (HuGE Navigator)
19375645 T3-induced genes identified basic transcription element binding protein 1/Kruppel-like factor 9 (BTEB1/KLF9) and GAR22 as TR target genes
12584248 The beta isoforms of hGAR17 and hGAR22 appear to be able to crosslink microtubules and microfilaments

AA Sequence

MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGTTLCQHANAVT      1 - 70
EAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCL     71 - 140
LEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAAGEDTTETAPAPGTPARGPRMTPSDLRNLDE    141 - 210
LVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTA    211 - 280
HRPPQPRVCTFSPQRVSPTTSPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPRPRDQLPPHPRSRR    281 - 350
YSGDSDSSASSAQSGPLGTRSDDTGTGPRRERPSRRLTTGTPASPRRPPALRSQSRDRLDRGRPRGAPGG    351 - 420
RGAQLSVPSPARRARSQSREEQAVLLVRRDRDGQHSWVPRGRGSGGSGRSTPQTPRARSPAAPRLSRVSS    421 - 490
PSPELGTTPASIFRTPLQLDPQQEQQLFRRLEEEFLANARALEAVASVTPTGPVPDPARAPDPPAPDSAY    491 - 560
CSSSSSSSSLSVLGGKCGQPGDSGRTANGLPGPRSQALSSSSDEGSPCPGMGGPLDAPGSPLACTEPSRT    561 - 630
WARGRMDTQPDRKPSRIPTPRGPRRPSGPAELGTWHALHSVTPRAEPDSWM                       631 - 681
//

Text Mined References (20)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24706950 2014 GAS2-like proteins mediate communication between microtubules and actin through interactions with end-binding proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20537721 2011 An association study on polymorphisms in the PEA15, ENTPD4, and GAS2L1 genes and schizophrenia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19375645 2009 GAR22: a novel target gene of thyroid hormone receptor causes growth inhibition in human erythroid cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
More...