Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.15
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.300 3.3e-02
atypical teratoid / rhabdoid tumor -1.500 7.9e-05
group 3 medulloblastoma -1.200 5.0e-03
medulloblastoma, large-cell -2.700 1.5e-07
osteosarcoma -1.632 7.4e-03
ovarian cancer 1.800 1.4e-05
primitive neuroectodermal tumor -1.400 1.2e-02
psoriasis -1.100 6.6e-03
tuberculosis 1.200 1.0e-04

Gene RIF (7)

AA Sequence

MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGTTLCQHANAVT      1 - 70
EAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCL     71 - 140
LEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAAGEDTTETAPAPGTPARGPRMTPSDLRNLDE    141 - 210
LVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTA    211 - 280
HRPPQPRVCTFSPQRVSPTTSPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPRPRDQLPPHPRSRR    281 - 350
YSGDSDSSASSAQSGPLGTRSDDTGTGPRRERPSRRLTTGTPASPRRPPALRSQSRDRLDRGRPRGAPGG    351 - 420
RGAQLSVPSPARRARSQSREEQAVLLVRRDRDGQHSWVPRGRGSGGSGRSTPQTPRARSPAAPRLSRVSS    421 - 490
PSPELGTTPASIFRTPLQLDPQQEQQLFRRLEEEFLANARALEAVASVTPTGPVPDPARAPDPPAPDSAY    491 - 560
CSSSSSSSSLSVLGGKCGQPGDSGRTANGLPGPRSQALSSSSDEGSPCPGMGGPLDAPGSPLACTEPSRT    561 - 630
WARGRMDTQPDRKPSRIPTPRGPRRPSGPAELGTWHALHSVTPRAEPDSWM                       631 - 681
//

Text Mined References (21)

PMID Year Title