Property Summary

Ligand Count 229
NCBI Gene PubMed Count 74
PubMed Score 157.77
PubTator Score 86.68

Knowledge Summary

Patent (18,250)

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma 1.100 7.3e-03
astrocytoma 1.200 4.5e-08
Astrocytoma, Pilocytic 1.700 5.5e-06
atypical teratoid / rhabdoid tumor 1.100 4.4e-02
Breast cancer 5.100 2.4e-02
ductal carcinoma in situ 1.200 7.7e-03
ependymoma 2.000 7.6e-03
glioblastoma 1.500 1.0e-05
interstitial cystitis 1.600 4.1e-03
intraductal papillary-mucinous adenoma (... -2.500 1.5e-04
intraductal papillary-mucinous carcinoma... -2.600 6.9e-04
intraductal papillary-mucinous neoplasm ... -2.400 3.0e-03
invasive ductal carcinoma 1.300 1.1e-02
osteosarcoma 2.228 4.1e-03
ovarian cancer 1.100 5.8e-04
pancreatic cancer 2.000 1.0e-03
Pick disease 1.600 2.7e-02
pituitary cancer -2.000 1.4e-05
primary pancreatic ductal adenocarcinoma 1.963 3.3e-04
primary Sjogren syndrome 1.300 4.9e-03
primitive neuroectodermal tumor 1.200 8.7e-03
tuberculosis 1.700 6.1e-04
ulcerative colitis 2.300 1.8e-04
X-linked cerebral adrenoleukodystrophy -1.900 3.6e-02

Gene RIF (47)

AA Sequence

MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKF      1 - 70
HNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTM     71 - 140
IKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVT    141 - 210
IVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKA    211 - 280
QWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPK    281 - 350
VKEDLPHTAPSSCIMDKNAALQNGIFCN                                              351 - 378
//

Text Mined References (77)

PMID Year Title