Property Summary

NCBI Gene PubMed Count 67
PubMed Score 148.37
PubTator Score 86.68

Knowledge Summary

Patent (18,250)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
glioblastoma multiforme 347 1.0385767391336E-17
posterior fossa group A ependymoma 1511 1.43165396051219E-17
astrocytoma 1493 4.45869841269924E-8
pilocytic astrocytoma 3086 7.58802754720277E-6
pituitary cancer 1972 1.41829566219441E-5
osteosarcoma 7933 4.00133154711357E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.50567577374266E-4
ulcerative colitis 2087 1.80195966630242E-4
primary pancreatic ductal adenocarcinoma 1271 3.31891749055087E-4
tuberculosis 1563 6.10031110224207E-4
pediatric high grade glioma 2712 6.3627570336955E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.91465603979877E-4
pancreatic cancer 2300 0.00101296032354352
ovarian cancer 8492 0.00217837994893581
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00300146771509511
interstitial cystitis 2299 0.00414081750600592
primary Sjogren syndrome 789 0.00488106066545528
ductal carcinoma in situ 1745 0.00766888297290591
primitive neuroectodermal tumor 3031 0.00869727080917521
invasive ductal carcinoma 2950 0.0111499115492496
Breast cancer 3099 0.0237535027308865
Pick disease 1893 0.0271905473026723
X-linked cerebral adrenoleukodystrophy 115 0.0359783766351972
atypical teratoid / rhabdoid tumor 4369 0.0439108990077523
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 3.913 2.0

Expression

Synonym

Accession Q99500 Q5SQD8 Q7Z5I2 S1P receptor 3
Symbols EDG3
LPB3
S1P3
EDG-3

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

  TechDev Info (2)

MLP Assay (18)

AID Type Active / Inconclusive / Inactive Description
373 screening 62 / 0 / 59743 S1P3 Agonist Primary HTS and Confirmation Assays
439 confirmatory 13 / 0 / 56 S1P3 Agonist Dose-Response Potency Assay
484 confirmatory 14 / 0 / 182 Dose Response Assay for S1P3 Antagonists
485 screening 462 / 0 / 168776 Primary HTS Assay for S1P3 Antagonists
730 confirmatory 1 / 0 / 50 S1P3 Dose Response Assay Counterscreen for 5-Hydroxytryptamine(Serotonin) Receptor Subtype 1E Agonists
776 confirmatory 21 / 0 / 23 S1P3 Dose Response Assay Counterscreen for 5-Hydroxytryptamine(Serotonin) Receptor Subtype 1E Antagonists
1192 confirmatory 2 / 0 / 8 Dose Response Cell-Based Assay for Agonists of the Sphingosine 1-Phosphate Receptor 3 (S1P3): Purchased Analogues
1429 screening 63 / 0 / 174 Confirmation cell-based assay to identify antagonists of the Sphingosine 1-Phosphate Receptor 3 (S1P3)
1518 confirmatory 17 / 0 / 14 Dose response cell-based high throughput screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 3 (S1P3)
1820 summary 0 / 0 / 0 Summary of probe development efforts to identify antagonists of Sphingosine 1-Phosphate Receptor 3 (S1P3)
More...

Gene RIF (40)

PMID Text
25971967 TRPC1 functions as a major regulator of S1P3 and VEGFR2 expression.
25832730 S1pr3 promotes leukocyte rolling by mobilization of endothelial P-selectin.
25254944 Stimulation with sphingosine-1-phosphate enhances cancer stem cells via S1PR3 and subsequent Notch1 activation.
24903384 Data show that sphingosine kinase SphK1 and sphingosine-1-phosphate (S1P) receptors S1P1, S1P2, S1P3, and S1P5 were expressed from primary, up to recurrent and secondary glioblastomas, with sphingosine kinase SphK2 levels were highest in primary tumors.
24851274 Data indicate that sphingosine 1-phosphate (S1P) and hepatocyte growth factor (HGF) induced transloaction of integrin beta4, S1P receptors S1PR2 and S1PR3 to endothelial cell membrane caveolin-enriched microdomains (CEMs).
24064218 a novel signaling axis, i.e., ROCK-JNK-ETS-1-CD44 pathway, which plays an essential role in the S1P3-regulated chemotactic response.
24038457 we provide evidences that S1PR1/3, but not S1PR2, negatively regulate the expression of collagen in hMSCs using cellular and molecular approaches in vitro
23918395 Sphingosine 1-phosphate receptor 3 regulates recruitment of anti-inflammatory monocytes to microvessels during implant arteriogenesis.
23911438 associations were found for 2 promoter SNPs across 2 European descent samples supporting association of alleles -1899G and -1785C with decreased risk for sepsis-associated acute respiratory distress syndrome (ARDS); alleles reduced transcription factor binding to S1PR3 promoter and S1PR3 promoter activity; associated with lower plasma S1PR3 protein in ARDS patients
23589284 S1PR agonists are pro-fibrotic via S1P2R and S1P3R stimulation using Smad-independent pathways.
More...

AA Sequence

MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKF      1 - 70
HNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTM     71 - 140
IKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVT    141 - 210
IVILYARIYFLVKSSSRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKA    211 - 280
QWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPK    281 - 350
VKEDLPHTAPSSCIMDKNAALQNGIFCN                                              351 - 378
//

Text Mined References (70)

PMID Year Title
25971967 2015 Transient Receptor Potential Canonical 1 (TRPC1) Channels as Regulators of Sphingolipid and VEGF Receptor Expression: IMPLICATIONS FOR THYROID CANCER CELL MIGRATION AND PROLIFERATION.
25832730 2015 Sphingosine-1-phosphate receptor 3 promotes leukocyte rolling by mobilizing endothelial P-selectin.
25254944 2014 Sphingosine-1-phosphate promotes expansion of cancer stem cells via S1PR3 by a ligand-independent Notch activation.
24903384 2014 The role of sphingosine kinase isoforms and receptors S1P1, S1P2, S1P3, and S1P5 in primary, secondary, and recurrent glioblastomas.
24851274 2014 Interaction of integrin ?4 with S1P receptors in S1P- and HGF-induced endothelial barrier enhancement.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
24064218 2013 ETS-1-mediated transcriptional up-regulation of CD44 is required for sphingosine-1-phosphate receptor subtype 3-stimulated chemotaxis.
24038457 2014 Sphingosine 1-phosphate receptors negatively regulate collagen type I/III expression in human bone marrow-derived mesenchymal stem cell.
23918395 2013 Sphingosine 1-phosphate receptor 3 regulates recruitment of anti-inflammatory monocytes to microvessels during implant arteriogenesis.
23911438 2013 Functional promoter variants in sphingosine 1-phosphate receptor 3 associate with susceptibility to sepsis-associated acute respiratory distress syndrome.
More...