Property Summary

NCBI Gene PubMed Count 328
PubMed Score 835.46
PubTator Score 581.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.900 9.6e-03
Multiple myeloma 1.489 1.1e-04
ovarian cancer 1.100 3.5e-02
pancreatic ductal adenocarcinoma liver m... -1.154 4.9e-02
Waldenstrons macroglobulinemia 1.203 2.8e-03

Synonym

Accession Q99497 B2R4Z1 O14805 Q6DR95 Q7LFU2
Symbols DJ1
DJ-1
GATD2
HEL-S-67p

Gene

PDB

1J42   1P5F   1PDV   1PDW   1PE0   1Q2U   1SOA   1UCF   2OR3   2R1T   2R1U   2R1V   2RK3   2RK4   2RK6   3B36   3B38   3B3A   3BWE   3CY6   3CYF   3CZ9   3CZA   3EZG   3F71   3SF8   4BTE   4MNT   4MTC   4N0M   4N12   4OGF   4OQ4   4P2G   4P34   4P35   4P36   4RKW   4RKY   4S0Z   4ZGG   5IP5   5SY6   5SY9   5SYA  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (295)

AA Sequence

MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVV      1 - 70
VLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYT     71 - 140
YSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD                         141 - 189
//

Text Mined References (332)

PMID Year Title