Property Summary

NCBI Gene PubMed Count 304
Grant Count 342
R01 Count 126
Funding $50,907,846.35
PubMed Score 744.91
PubTator Score 581.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.203 0.003
Multiple myeloma 1.489 0.000
pancreatic ductal adenocarcinoma liver m... -1.154 0.049
diabetes mellitus 2.000 0.003
ovarian cancer 1.100 0.035

Synonym

Accession Q99497 B2R4Z1 O14805 Q6DR95 Q7LFU2 DJ-1
Symbols DJ1
DJ-1
HEL-S-67p

Gene

PDB

1J42   1P5F   1PDV   1PDW   1PE0   1Q2U   1SOA   1UCF   2OR3   2R1T   2R1U   2R1V   2RK3   2RK4   2RK6   3B36   3B38   3B3A   3BWE   3CY6   3CYF   3CZ9   3CZA   3EZG   3F71   3SF8   4BTE   4MNT   4MTC   4N0M   4N12   4OGF   4OQ4   4P2G   4P34   4P35   4P36   4RKW   4RKY   4S0Z   4ZGG  

Gene RIF (272)

PMID Text
26995087 DJ-1 deglycase plays a major role in preventing protein glycation in eukaryotic cells and might be important for preventing skin glycation
26780326 these findings demonstrate that SETD6 negatively regulates the Nrf2-mediated oxidative stress response through a physical and catalytically independent interaction with DJ1 at chromatin.
26739068 The L10P DJ-1 mutation results in a toxic protein, which lacks the protective function of wild-type protein on mitochondria due to the decrease in the ability of anti-oxidative stress
26624998 S. pombe homologs of DJ-1 are stationary-phase associated proteins.
26390688 Overexpression of PI3K-p110alpha is associated with progression of uterine cervical neoplasia, and the expression of pAkt and DJ-1 is positively correlated with PI3K-p110alpha expression in this process.
26305376 Our study suggests that DJ-1 may also play a role in regulating dopamine levels by modifying DAT activity.
26261582 Sensitivity of breast cancer cells to adriamycin was significantly improved with the transfection of DJ-1 siRNA.
26254420 PARK7 interactome is involved in novel pathways pertinent in MPM disease.
26245297 High expression of PARK7 might lead to the occurrence of non-small-cell lung cancer.
26125099 DJ-1 is increased in elderly lung cancer patients with malignant pleural effusions and may have a role in redox regulation
More...

AA Sequence

MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVV      1 - 70
VLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYT     71 - 140
YSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD                         141 - 189
//

Text Mined References (307)

PMID Year Title
26995087 2016 The Parkinsonism-associated protein DJ-1/Park7 prevents glycation damage in human keratinocyte.
26780326 2016 SETD6 is a negative regulator of oxidative stress response.
26739068 2015 L10P mutation in DJ-1 gene induced oxidative stress and mitochondrial disfunction.
26624998 2015 Schizosaccharomyces pombe Homologs of Human DJ-1 Are Stationary Phase-Associated Proteins That Are Involved in Autophagy and Oxidative Stress Resistance.
26390688 2015 Overexpression of PI3K-p110? in the progression of uterine cervical neoplasia and its correlation with pAkt and DJ-1.
26305376 2015 A Physical Interaction between the Dopamine Transporter and DJ-1 Facilitates Increased Dopamine Reuptake.
26261582 2015 Role of DJ-1 siRNA in reverse sensitivity of breast cancer cells to chemotherapy and its possible mechanism.
26254420 2015 Computational genomic analysis of PARK7 interactome reveals high BBS1 gene expression as a prognostic factor favoring survival in malignant pleural mesothelioma.
26245297 2015 Status of the Parkinson's disease gene family expression in non-small-cell lung cancer.
26125099 2015 Pleural effusion levels of DJ-1 are increased in elderly lung cancer patients with malignant pleural effusions.
More...