Property Summary

NCBI Gene PubMed Count 65
Grant Count 37
R01 Count 20
Funding $2,818,825.83
PubMed Score 105.54
PubTator Score 187.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.300 0.004
oligodendroglioma -1.200 0.004
breast carcinoma 1.100 0.001

Gene RIF (38)

PMID Text
26450788 Our findings support the notion that epigenetic regulators, such as RNF2, directly and functionally control powerful gene networks that are vital in multiple cancer processes.
26151332 The enzymatic activity of BMI1 and RING1B were evaluated and compared.
26100231 O-GlcNAc modifies and regulates an essential epigenetic tool, RING1B, which may contribute to human embryonic stem cells pluripotency maintenance and differentiation.
25451922 BAP1 deficiency causes increased expression of FoxK2 target genes in a Ring1B-Bmi1-dependent manner
25431952 combinatorial silencing along with Ezh2 depleted epigenetically modified H2- and H3-histones and inhibited pancreatic cancer cell growth in vitro and in vivo (xenograft model)
24903147 Ring1B and the SNAG-associated chromatin modifier EZH2 formed distinct protein complexes with Snail and that EZH2 was required for Snail-Ring1A/B recruitment to the target promoter.
24813883 Authors describe a critical role for the polycomb group protein Ring1b in nonhomologous end-joining (NHEJ)-mediated end-to-end chromosome fusions.
24796740 Data indicate that RING finger protein 2 (RNF2) knockdown can increase the sensitivity of U87 cells to X ray radiation.
24742605 we identify p63 as a target of Ring1B to regulate Fak expression in breast cancer epithelial cells
24614341 Bmi1 and possibly RNF2 may be attractive biomarkers of gemcitabine resistance in the context of RRM1 expression.
More...

AA Sequence

MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHR      1 - 70
FCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQAL     71 - 140
SHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNN    141 - 210
NAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQ    211 - 280
MNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK                  281 - 336
//

Text Mined References (70)

PMID Year Title
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26450788 2015 Dual Roles of RNF2 in Melanoma Progression.
26151332 2015 BMI1-RING1B is an autoinhibited RING E3 ubiquitin ligase.
26100231 2015 RING1B O-GlcNAcylation regulates gene targeting of polycomb repressive complex 1 in human embryonic stem cells.
25519132 2014 An AUTS2-Polycomb complex activates gene expression in the CNS.
25451922 2015 BRCA1-associated protein 1 (BAP1) deubiquitinase antagonizes the ubiquitin-mediated activation of FoxK2 target genes.
25431952 2014 H2AK119Ub1 and H3K27Me3 in molecular staging for survival prediction of patients with pancreatic ductal adenocarcinoma.
24903147 2014 Snail recruits Ring1B to mediate transcriptional repression and cell migration in pancreatic cancer cells.
24813883 2014 Isolation of chromatin from dysfunctional telomeres reveals an important role for Ring1b in NHEJ-mediated chromosome fusions.
More...