Property Summary

NCBI Gene PubMed Count 75
PubMed Score 115.68
PubTator Score 187.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
breast carcinoma 1638 6.6e-04
astrocytic glioma 2597 3.7e-03
oligodendroglioma 2850 4.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.300 3.7e-03
breast carcinoma 1.100 6.6e-04
oligodendroglioma -1.200 4.1e-03

Protein-protein Interaction (3)

Gene RIF (40)

AA Sequence

MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHR      1 - 70
FCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQAL     71 - 140
SHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNN    141 - 210
NAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQ    211 - 280
MNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK                  281 - 336
//

Text Mined References (82)

PMID Year Title