Property Summary

NCBI Gene PubMed Count 17
Grant Count 6
R01 Count 6
Funding $370,392.75
PubMed Score 98.06
PubTator Score 25.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pilocytic astrocytoma 1.100 0.000
posterior fossa group B ependymoma 1.300 0.000
subependymal giant cell astrocytoma 1.094 0.015
psoriasis -1.400 0.000

Gene RIF (5)

PMID Text
25747990 Characterization of the enzymatic and structural properties of human D-aspartate oxidase and comparison with those of the rat and mouse enzymes
25689573 There is a significant increase in DDO mRNA expression in the prefrontal cortex of patients with schizophrenia compared to controls.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19125110 data do not suggest that DDO plays a role in the etiology of schizophrenia in the German population
18976975 Knockdown of D-aspartate oxidase (DDO) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRE      1 - 70
TFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLK     71 - 140
CECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPW    141 - 210
VEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPY    211 - 280
RPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL             281 - 341
//

Text Mined References (19)

PMID Year Title
25747990 2015 Characterization of the enzymatic and structural properties of human D-aspartate oxidase and comparison with those of the rat and mouse enzymes.
25689573 2015 A role for D-aspartate oxidase in schizophrenia and in schizophrenia-related symptoms induced by phencyclidine in mice.
20603179 2010 Thiolactomycin inhibits D-aspartate oxidase: a novel approach to probing the active site environment.
20564561 2010 Comparative characterization of three D-aspartate oxidases and one D-amino acid oxidase from Caenorhabditis elegans.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19125110 2009 No association between the D-aspartate oxidase locus and schizophrenia.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...