Property Summary

Ligand Count 1
NCBI Gene PubMed Count 19
PubMed Score 105.82
PubTator Score 25.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
Pilocytic astrocytoma 1.100 2.6e-05
posterior fossa group B ependymoma 1.300 1.6e-06
psoriasis -1.400 6.7e-26
subependymal giant cell astrocytoma 1.094 1.5e-02

Gene RIF (7)

AA Sequence

MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRE      1 - 70
TFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLK     71 - 140
CECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPW    141 - 210
VEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPY    211 - 280
RPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL             281 - 341
//

Text Mined References (21)

PMID Year Title