Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.53
PubTator Score 3.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.9e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.750 2.9e-06

Synonym

Accession Q99487 D3DPK1 O15458 Q5SY02
Symbols HSD-PLA2

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNK      1 - 70
RCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRS     71 - 140
AATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFN    141 - 210
ILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFI    211 - 280
NTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV    281 - 350
RAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL                                351 - 392
//

Text Mined References (13)

PMID Year Title