Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.19
PubTator Score 3.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.750 0.000

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
492956 screening 3326 / 0 / 332135 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of human platelet activating factor acetylhydrolase 2 (PAFAH2)
492969 summary 1 / 0 / 0 Summary of the probe development efforts to identify inhibitors of human platelet activating factor acetylhydrolase 2 (PAFAH2)
493030 screening 1510 / 0 / 831 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of human platelet activating factor acetylhydrolase 2 (PAFAH2)

Gene RIF (6)

PMID Text
25707358 The oligomeric state of PAFAH-II drives functional protein trafficking. PAFAH-II localization to the membrane is critical for substrate acquisition and effective oxidative stress protection.
17272759 PAF-AH II exerts strong neuroprotective effects against ischemic injury: the neurological deficit scores, cerebral edema index, and relative infarction volume are all significantly lower in PAFAH2 transgenic mice than in wild-type mice.
17157859 Lp-PLA2 was higher in those with more extensive Coronary artery disease
16650870 Observational study of gene-disease association. (HuGE Navigator)
12406338 presence of platelet-activating factor acetylhydrolase II in a restricted pattern in human skin; it is involved in protecting this organ against oxidative stress through the degradation of oxidatively modified bioactive phospholipids.
11294621 examines substrate specificity for intracellular and plasma PAF-AHs

AA Sequence

MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNK      1 - 70
RCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRS     71 - 140
AATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFN    141 - 210
ILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFI    211 - 280
NTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV    281 - 350
RAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL                                351 - 392
//

Text Mined References (12)

PMID Year Title
25707358 2015 Oligomeric state regulated trafficking of human platelet-activating factor acetylhydrolase type-II.
17272759 2007 Neuroprotective role of transgenic PAF-acetylhydrolase II in mouse models of focal cerebral ischemia.
17157859 2008 Lipoprotein-associated phospholipase A2 concentrations in plasma are associated with the extent of coronary artery disease and correlate to adipose tissue levels of marine n-3 fatty acids.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16650870 2006 A single nucleotide polymorphism in the plasma PAF acetylhydrolase gene and risk of atherosclerosis in Japanese patients with peripheral artery occlusive disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406338 2002 Identification of platelet-activating factor acetylhydrolase II in human skin.
11294621 2001 Platelet-activating factor acetylhydrolases: broad substrate specificity and lipoprotein binding does not modulate the catalytic properties of the plasma enzyme.
9494101 1998 Expression, purification and characterization of a human serine-dependent phospholipase A2 with high specificity for oxidized phospholipids and platelet activating factor.
More...