Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.60
PubTator Score 85.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSM      1 - 70
YVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQ     71 - 140
QLTALGAAQATAKA                                                            141 - 154
//

Text Mined References (26)

PMID Year Title