Property Summary

NCBI Gene PubMed Count 19
Grant Count 15
Funding $828,214.09
PubMed Score 9.27
PubTator Score 85.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
23720755 knockdown of PFD2 and PFD5 disrupted prefoldin formation in HTT-expressing cells, resulting in accumulation of aggregates of a pathogenic form of HTT and in induction of cell death.
22844532 Rabring7 stimulates c-Myc degradation via mono-ubiquitination of MM-1
18398700 MM-1, a c-Myc interacting protein, interacts with HCV ARFP/F protein, which can result in the enhancement of the c-Myc activity.
18281035 Wnt4 gene, a member of the Wnt-beta-catenin pathway, was identified as a target gene of MM-1.
16173081 MM-1alpha, MM-1gamma, and MM-1gamma, but not MM-1beta, were found to repress transcription activity of c-Myc
11844794 interaction with p73

AA Sequence

MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSM      1 - 70
YVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQ     71 - 140
QLTALGAAQATAKA                                                            141 - 154
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23720755 2013 Prefoldin protects neuronal cells from polyglutamine toxicity by preventing aggregation formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22844532 2012 Rabring7 degrades c-Myc through complex formation with MM-1.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18398700 2008 Hepatitis C virus ARFP/F protein interacts with cellular MM-1 protein and enhances the gene trans-activation activity of c-Myc.
More...