Property Summary

NCBI Gene PubMed Count 8
Grant Count 42
R01 Count 24
Funding $6,406,444.16
PubMed Score 71.99
PubTator Score 6.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
psoriasis -1.700 0.000
non-small cell lung cancer -1.735 0.000
lung cancer -2.600 0.001
lung adenocarcinoma -1.400 0.000
pituitary cancer 1.800 0.011

AA Sequence

MIPPSSPREDGVDGLPKEAVGAEQPPSPASTSSQESKLQKLKRSLSFKTKSLRSKSADNFFQRTNSEDMK      1 - 70
LQAHMVAEISPSSSPLPAPGSLTSTPARAGLHPGGKAHAFQEYIFKKPTFCDVCNHMIVGTNAKHGLRCK     71 - 140
ACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPLLIHEQFGCIKEVMPIACGNKVDPVYETLRFGTSLA    141 - 210
QRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSL    211 - 280
SKDPLQMNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFR    281 - 350
CVRTFIGCKEQGQITLKENQICVSSEEEQDGFIRVLSGKKKGLIPLDVLENI                      351 - 402
//

Text Mined References (8)

PMID Year Title
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
22704111 2012 Pilot genome-wide association search identifies potential loci for risk of erectile dysfunction in type 1 diabetes using the DCCT/EDIC study cohort.
21812934 2011 Identification of candidate substrates for poly(ADP-ribose) polymerase-2 (PARP2) in the absence of DNA damage using high-density protein microarrays.
16260042 2006 Rapid identification of 14-3-3-binding proteins by protein microarray analysis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10393425 1999 Assignment of STAC to human chromosome band 3p22.3 between D3S3718 and D3S1611.
8954993 1996 Stac, a novel neuron-specific protein with cysteine-rich and SH3 domains.