Property Summary

NCBI Gene PubMed Count 9
PubMed Score 79.56
PubTator Score 6.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Dermatitis, Allergic Contact 67 0.0 0.0
Disease Target Count P-value
non-small cell lung cancer 2799 1.6e-21
lung adenocarcinoma 2627 8.7e-14
malignant mesothelioma 3135 1.9e-04
pituitary cancer 1915 1.1e-02
lung cancer 4607 2.8e-02
psoriasis 6514 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Melanoma 689 0.0 0.5
Skin cancer 451 0.0 0.5
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 268 0.0 0.8
Disease Target Count Z-score Confidence
Native American myopathy 4 4.186 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
lung adenocarcinoma -1.400 8.7e-14
lung cancer -1.200 2.8e-02
malignant mesothelioma 1.700 1.9e-04
non-small cell lung cancer -1.735 1.6e-21
pituitary cancer 1.800 1.1e-02
psoriasis -1.100 3.8e-02

Gene RIF (1)

AA Sequence

MIPPSSPREDGVDGLPKEAVGAEQPPSPASTSSQESKLQKLKRSLSFKTKSLRSKSADNFFQRTNSEDMK      1 - 70
LQAHMVAEISPSSSPLPAPGSLTSTPARAGLHPGGKAHAFQEYIFKKPTFCDVCNHMIVGTNAKHGLRCK     71 - 140
ACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPLLIHEQFGCIKEVMPIACGNKVDPVYETLRFGTSLA    141 - 210
QRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSL    211 - 280
SKDPLQMNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFR    281 - 350
CVRTFIGCKEQGQITLKENQICVSSEEEQDGFIRVLSGKKKGLIPLDVLENI                      351 - 402
//

Text Mined References (9)

PMID Year Title