Property Summary

NCBI Gene PubMed Count 32
PubMed Score 53.06
PubTator Score 29.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 2.0e-03
interstitial cystitis 2.100 2.3e-03
lung adenocarcinoma 1.400 1.6e-08
non-small cell lung carcinoma 1.100 5.3e-13
osteosarcoma -1.991 6.4e-07

Protein-protein Interaction (1)

Gene RIF (22)

AA Sequence

MAFDVSCFFWVVLFSAGCKVITSWDQMCIEKEANKTYNCENLGLSEIPDTLPNTTEFLEFSFNFLPTIHN      1 - 70
RTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLIFMAETSLNGPKSLKHLFLIQTGISNL     71 - 140
EFIPVHNLENLESLYLGSNHISSIKFPKDFPARNLKVLDFQNNAIHYISREDMRSLEQAINLSLNFNGNN    141 - 210
VKGIELGAFDSTIFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLN    211 - 280
LQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHL    281 - 350
YIRGNVKKLHLGVGCLEKLGNLQTLDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECP    351 - 420
QLELLDLAFTRLHINAPQSPFQNLHFLQVLNLTYCFLDTSNQHLLAGLPVLRHLNLKGNHFQDGTITKTN    421 - 490
LLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSLSHLKGIYLNLAANSINIISP    491 - 560
RLLPILSQQSTINLSHNPLDCTCSNIHFLTWYKENLHKLEGSEETTCANPPSLRGVKLSDVKLSCGITAI    561 - 630
GIFFLIVFLLLLAILLFFAVKYLLRWKYQHI                                           631 - 661
//

Text Mined References (35)

PMID Year Title