Property Summary

NCBI Gene PubMed Count 28
Grant Count 34
R01 Count 11
Funding $4,973,678.85
PubMed Score 47.86
PubTator Score 29.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 0.002
osteosarcoma -1.991 0.000
interstitial cystitis 2.100 0.002
lung adenocarcinoma 1.400 0.000
non-small cell lung carcinoma 1.100 0.000

Gene RIF (19)

PMID Text
26555723 By associating with PIM-1L, CD180 can thus obtain autonomous signaling capabilities, and this complex is then channeling inflammatory signals into B cell survival programs
25879560 Since MEC1 cells are derived from a CLL patient with mutated IGVH genes (M-CLL) negative correlation between CD180 and CD32 expression on cycling MEC1 cells could be limited to M-CLL.
25802446 we address of monocytes functional status through assessment of the patterns of expression of Fcgamma receptors CD64, CD32, CD16 and CD180 receptor on monocytes from CLL patients and healthy individuals using specific mAbs and flow cytometry.
23103284 Data indicate that TLR9-signaling as a crucial factor for turning retinoic acid (RA) into a strong stimulator of RP105-mediated B-cell proliferation.
22484241 IL-4 failed to up-regulate expression of RP105 at the cell surface. In conclusion, the anti-inflammatory actions of IL-4 occur independently of IL-10, RP105, and the kinase activity of RIPK2
21959264 Both mouse and human RP105/MD-1 exhibit dimerization of the 1:1 RP105/MD-1 complex, demonstrating a novel organization.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20430725 Data show that CD180, CD284 and CD14 expression is higher on normal B cells than on CD19+ B-cell chronic lymphocytic leukaemia cells.
20406964 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAFDVSCFFWVVLFSAGCKVITSWDQMCIEKEANKTYNCENLGLSEIPDTLPNTTEFLEFSFNFLPTIHN      1 - 70
RTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLIFMAETSLNGPKSLKHLFLIQTGISNL     71 - 140
EFIPVHNLENLESLYLGSNHISSIKFPKDFPARNLKVLDFQNNAIHYISREDMRSLEQAINLSLNFNGNN    141 - 210
VKGIELGAFDSTIFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLN    211 - 280
LQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHL    281 - 350
YIRGNVKKLHLGVGCLEKLGNLQTLDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECP    351 - 420
QLELLDLAFTRLHINAPQSPFQNLHFLQVLNLTYCFLDTSNQHLLAGLPVLRHLNLKGNHFQDGTITKTN    421 - 490
LLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSLSHLKGIYLNLAANSINIISP    491 - 560
RLLPILSQQSTINLSHNPLDCTCSNIHFLTWYKENLHKLEGSEETTCANPPSLRGVKLSDVKLSCGITAI    561 - 630
GIFFLIVFLLLLAILLFFAVKYLLRWKYQHI                                           631 - 661
//

Text Mined References (31)

PMID Year Title
26555723 2015 Human CD180 Transmits Signals via the PIM-1L Kinase.
25879560 2015 Correlation of the expression of CD32 and CD180 receptors on CLL cells and MEC1 cell line.
25802446 2015 Aberrant expression of Fc?-receptors and Toll like receptor CD180 on monocytes from patients with chronic lymphocytic leukaemia.
23103284 2012 TLR9-signaling is required for turning retinoic acid into a potent stimulator of RP105 (CD180)-mediated proliferation and IgG synthesis in human memory B cells.
22484241 2012 The anti-inflammatory actions of IL-4 in human monocytes are not mediated by IL-10, RP105 or the kinase activity of RIPK2.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21959264 2011 Crystal structures of mouse and human RP105/MD-1 complexes reveal unique dimer organization of the toll-like receptor family.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20430725 2009 Different expression of CD180, CD284 and CD14 receptors on the CD19+ subpopulation of normal and B-CLL lymphocytes.
More...