Property Summary

NCBI Gene PubMed Count 145
Grant Count 70
R01 Count 36
Funding $4,404,345.62
PubMed Score 520.19
PubTator Score 176.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.623 0.001
non-small cell lung cancer -1.539 0.000
lung cancer -1.600 0.000
breast carcinoma -1.500 0.000
fibroadenoma -1.600 0.013
interstitial cystitis 1.100 0.001
lung adenocarcinoma -2.000 0.000
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.200 0.007

Gene

 IMPC Term (1)

Gene RIF (123)

PMID Text
26605328 data are consistent with those obtained in previous studies that suggested that rs204993 is associated with schizophrenia and that the AA genotype of rs204993 demonstrates a higher risk
26530164 The expression of cytoplasmic Notch1 or nuclear Notch4 could also be upregulated by HBx in HepG2X cells. The upregulation of Notch1 by HBx was through p38 MAPK pathway.
26387946 Anti-estrogen resistance in human breast tumors is driven by JAG1-NOTCH4-dependent cancer stem cell activity.
26341090 High Notch4 expression is associated with Prostatic Intraepithelial Neoplasia.
25846406 Notch 3 and 4, and not Notch 1, were highly increased in human arteriovenous malformations.
25845235 The associations of rs2616984 in CSMD1 gene, putative associations of rs3131296 in NOTCH4 gene, and associations of rs2229741 of NRIP1 gene with Alzheimer's disease have been found in a Russian population.
25740432 Our findings provide a novel mechanism for Notch4-ICD regulation, suggesting a negative regulatory role for the PI3K-AKT pathway in Notch4 nuclear signaling.
25663545 BITC-mediated inhibition of bCSC was augmented by knockdown of Notch4 and Nicastrin, but not by RNA interference of Notch1 or Notch2.
25529856 NOTCH4 polymorphism can influence clinical symptoms in Slovenian patients with schizophrenia.
25511451 Study shows that Notch4 activation can promote gastric cancer growth by inducing Wnt1/b-catenin signaling.
More...

AA Sequence

MQPPSLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGETCQFPDPCQN      1 - 70
AQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLEDPCPPSFCSKRGRCHIQASGR     71 - 140
PQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCHCPPGFEGHACERDVNECFQDPGPCPKGTS    141 - 210
CHNTLGSFQCLCPVGQEGPRCELRAGPCPPRGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNC    211 - 280
VSHQCQNGGTCQDGLDTYTCLCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGT    281 - 350
SCEENLDDCIAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC    351 - 420
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTC    421 - 490
LDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLPGFSGTRCEEDIDECRSSPC    491 - 560
ANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPLCA    561 - 630
PNLCQPKQICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPC    631 - 700
AHGGTCYPQPSGYNCTCPTGYTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDY    701 - 770
CVSAPCFNGGTCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGS    771 - 840
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCHNGGLCVDS    841 - 910
GPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYDGQNCSKELDACQSQPCHNH    911 - 980
GTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPC    981 - 1050
HSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGY   1051 - 1120
GGPDCLTPPAPKGCGPPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAG   1121 - 1190
CSGPGGNWDGGDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH   1191 - 1260
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLRVGLWVR   1261 - 1330
KDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAGFVVVMGVDLSRCGPDHPASR   1331 - 1400
CPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAPPANQLPWPVLCSPVAGVILLALGALLVLQL   1401 - 1470
IRRRRREHGALWLPPGFTRRPRTQSAPHRRRPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQA   1471 - 1540
EETGPPSTCQLWSLSGGCGALPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWL   1541 - 1610
GCPEPWEPLLDGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR   1611 - 1680
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNARAA   1681 - 1750
RSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGLAPADVAHQRNHWDLLTLLE   1751 - 1820
GAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPRCRTLSAGAGPRGGGACLQARTWSVDLAARG   1821 - 1890
GGAYSHCRSLSGVGAGGGPTPRGRRFSAGMRGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACG   1891 - 1960
SASNIPIPPPCLTPSPERGSPQLDCGPPALQEMPINQGGEGKK                              1961 - 2003
//

Text Mined References (146)

PMID Year Title
26605328 2015 Association of the NOTCH4 Gene Polymorphism rs204993 with Schizophrenia in the Chinese Han Population.
26530164 2016 Hepatitis B virus X protein activates Notch signaling by its effects on Notch1 and Notch4 in human hepatocellular carcinoma.
26387946 2015 Anti-estrogen Resistance in Human Breast Tumors Is Driven by JAG1-NOTCH4-Dependent Cancer Stem Cell Activity.
26341090 2016 Characterization of Notch Signalling Pathway Members in Normal Prostate, Prostatic Intraepithelial Neoplasia (PIN) and Prostatic Adenocarcinoma.
25846406 2015 Notch receptor expression in human brain arteriovenous malformations.
25845235 [Replicative association analysis of genetic markers of cognitive traits with Alzheimer's disease in a Russian population].
25740432 2015 AKT and 14-3-3 regulate Notch4 nuclear localization.
25663545 2015 The role of polycomb group protein Bmi-1 and Notch4 in breast cancer stem cell inhibition by benzyl isothiocyanate.
25529856 2015 Genetic variability testing of neurodevelopmental genes in schizophrenic patients.
25511451 2015 Notch4 promotes gastric cancer growth through activation of Wnt1/?-catenin signaling.
More...