Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy -1.046 2.0e-03
Becker muscular dystrophy 1.484 3.3e-03
colon cancer -3.900 9.8e-13
dermatomyositis -1.100 2.2e-04
Duchenne muscular dystrophy 1.140 1.5e-04
medulloblastoma, large-cell 1.100 3.0e-04
osteosarcoma 1.829 4.9e-07
pituitary cancer 1.100 4.3e-02

AA Sequence

MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIIIFKKQRKAQNF      1 - 70
TSILIANLSLSDTLVCVMCIHFTIIYTLMDHWIFGDTMCRLTSYVQSVSISVSIFSLVFTAVERYQLIVN     71 - 140
PRGWKPSVTHAYWGITLIWLFSLLLSIPFFLSYHLTDEPFRNLSLPTDLYTHQVACVENWPSKKDRLLFT    141 - 210
TSLFLLQYFVPLGFILICYLKIVICLRRRNAKVDKKKENEGRLNENKRINTMLISIVVTFGACWLPRISS    211 - 280
MSSLTGIMRC                                                                281 - 290
//

Text Mined References (4)

PMID Year Title