Property Summary

NCBI Gene PubMed Count 55
PubMed Score 20.39
PubTator Score 1772.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.300 0.000
osteosarcoma 1.001 0.002
intraductal papillary-mucinous neoplasm ... 1.400 0.009
lung cancer 1.500 0.000
lung adenocarcinoma 1.050 0.000
ovarian cancer 1.800 0.000
dermatomyositis 1.100 0.005

Synonym

Accession Q99460 B8ZZH9 Q24JU0 Q53TI2 Q6GMU5 Q6P2P4 Q6PJM7 Q6PKG9 Q86VU1 Q8IV79
Symbols S1
P112
Rpn2

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5L4K  

 GO Function (1)

Gene RIF (36)

PMID Text
24910440 Together, our findings suggest that the interaction of Psmd1 with Adrm1 is controlled by SUMOylation in a manner that may alter proteasome composition and function.
24286321 Increased 26S proteasome non-ATPase regulatory subunit 1 in the aqueous humor of patients with age-related macular degeneration compared to control subjects.
22031102 The 26S proteasome plays a key role in promoting apoptosis induced by high doses of UV irradiation.
21044959 p38 MAPK negatively regulates the proteasome activity by phosphorylating Thr-273 of Rpn2
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18534977 analysis of how subunit radial displacements open the gate into the proteolytic core in the human 26S proteasome
16737963 neurotoxic products of inflammation, such as PGJ2, may play a role in neurodegenerative disorders by impairing 26 S proteasome activity and inducing a chain of events that culminates in neuronal cell death
14614829 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
More...

AA Sequence

MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYH      1 - 70
LGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQR     71 - 140
CLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEK    141 - 210
PDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPG    211 - 280
STNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDL    281 - 350
MILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEAL    351 - 420
QLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTAR    421 - 490
QDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRM    491 - 560
EEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVSDVNDDVRRAAVESLGFILFRTP    561 - 630
EQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTE    631 - 700
ITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFW    701 - 770
FWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAK    771 - 840
KKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGG    841 - 910
IIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD                               911 - 953
//

Text Mined References (67)

PMID Year Title
24910440 2014 SUMOylation of Psmd1 controls Adrm1 interaction with the proteasome.
24286321 2014 Increased 26S proteasome non-ATPase regulatory subunit 1 in the aqueous humor of patients with age-related macular degeneration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22031102 2011 MG132 inhibition of proteasome blocks apoptosis induced by severe DNA damage.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044959 2010 Osmotic stress inhibits proteasome by p38 MAPK-dependent phosphorylation.
More...