Property Summary

NCBI Gene PubMed Count 56
PubMed Score 21.16
PubTator Score 1772.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.100 4.9e-03
intraductal papillary-mucinous neoplasm ... 1.400 9.2e-03
lung adenocarcinoma 1.050 5.7e-08
lung cancer 1.100 4.0e-03
osteosarcoma 1.001 2.4e-03
ovarian cancer 1.800 1.1e-05
psoriasis 1.300 2.8e-08

Synonym

Accession Q99460 B8ZZH9 Q24JU0 Q53TI2 Q6GMU5 Q6P2P4 Q6PJM7 Q6PKG9 Q86VU1 Q8IV79
Symbols S1
P112
Rpn2

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5LN3   5M32   5T0C   5T0G   5T0H   5T0I   5T0J   5VGZ   5VHF   5VHH   5VHI   5VHS   5V1Y   5V1Z   5L4K   2NBK  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (35)

AA Sequence

MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYH      1 - 70
LGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQR     71 - 140
CLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEK    141 - 210
PDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPG    211 - 280
STNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDL    281 - 350
MILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEAL    351 - 420
QLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTAR    421 - 490
QDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRM    491 - 560
EEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVSDVNDDVRRAAVESLGFILFRTP    561 - 630
EQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTE    631 - 700
ITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFW    701 - 770
FWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAK    771 - 840
KKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGG    841 - 910
IIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD                               911 - 953
//

Text Mined References (71)

PMID Year Title