Property Summary

NCBI Gene PubMed Count 56
PubMed Score 21.16
PubTator Score 1772.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.100 4.9e-03
intraductal papillary-mucinous neoplasm ... 1.400 9.2e-03
lung adenocarcinoma 1.050 5.7e-08
lung cancer 1.100 4.0e-03
osteosarcoma 1.001 2.4e-03
ovarian cancer 1.800 1.1e-05
psoriasis 1.300 2.8e-08

 GO Function (1)

PDB (18)

Gene RIF (35)

AA Sequence

MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYH      1 - 70
LGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQR     71 - 140
CLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEK    141 - 210
PDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPG    211 - 280
STNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDL    281 - 350
MILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEAL    351 - 420
QLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTAR    421 - 490
QDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRM    491 - 560
EEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVSDVNDDVRRAAVESLGFILFRTP    561 - 630
EQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTE    631 - 700
ITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFW    701 - 770
FWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAK    771 - 840
KKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGG    841 - 910
IIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD                               911 - 953
//

Text Mined References (71)

PMID Year Title