Property Summary

NCBI Gene PubMed Count 119
PubMed Score 315.44
PubTator Score 262.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
colon cancer 1478 1.7e-07
medulloblastoma, large-cell 6241 5.4e-03
aldosterone-producing adenoma 665 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 2.3

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma -1.058 2.3e-02
colon cancer -2.500 1.7e-07
medulloblastoma, large-cell 1.900 5.4e-03

 GO Component (1)

Gene RIF (111)

AA Sequence

MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTL      1 - 70
RDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEA     71 - 140
RVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGPNPNPTPSCGA    141 - 210
NGGGGGGPSPAGAPGAAGPGGPGGEPGKGGAAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPI    211 - 280
TSIPDSLGGPFASVLSSLQRPNGAKAALVKSSMF                                        281 - 314
//

Text Mined References (117)

PMID Year Title