Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.53
PubTator Score 14.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.7e-10
ovarian cancer 8520 2.3e-06
group 4 medulloblastoma 1855 2.7e-04

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.100 2.7e-04
juvenile dermatomyositis -1.045 1.7e-10
ovarian cancer -1.200 2.3e-06

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPV      1 - 70
FTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKR     71 - 140
TQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQ    141 - 210
PGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRY    211 - 280
VSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII    281 - 350
TNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF                                   351 - 389
//

Text Mined References (20)

PMID Year Title