Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.33
PubTator Score 14.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
sonic hedgehog group medulloblastoma -1.200 0.000
juvenile dermatomyositis -1.045 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q99447 B7Z7A5 B7ZAS0 F5H8B1 Q6IBM3 Q96G08
Symbols ET

Gene

PANTHER Protein Class (2)

PDB

3ELB   4XSV  

Gene RIF (6)

PMID Text
24802409 These results suggest that the N-terminal CT domain of hECT contributes to its catalytic reaction, but C-terminal CT domain does not.
24519946 differences in phosphorylation between Pcyt2 isoforms
22339418 Pcyt2 expression is responsive to tumor nutritional micro-environment, up-regulated in response to metabolic stress under conditions of serum deprivation.
18976975 Knockdown of phosphate cytidylyltransferase 2, ethanolamine (PCYT2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18583706 EGR1 is an important transcriptional stimulator of the human PCYT2 and that conditions that modify EGR1 also affect the function of ECT and consequently PE synthesis
16023412 The Pcyt2 promoter is driven by a functional CAAT box (-90/-73) and by negative (-385/-255) and positive regulatory elements (-255/-153) in the upstream regions.

AA Sequence

MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPV      1 - 70
FTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKR     71 - 140
TQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQ    141 - 210
PGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRY    211 - 280
VSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII    281 - 350
TNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF                                   351 - 389
//

Text Mined References (20)

PMID Year Title
24802409 2014 Human CTP:phosphoethanolamine cytidylyltransferase: enzymatic properties and unequal catalytic roles of CTP-binding motifs in two cytidylyltransferase domains.
24519946 2014 Isoform-specific and protein kinase C-mediated regulation of CTP:phosphoethanolamine cytidylyltransferase phosphorylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22339418 2012 Breast cancer cells adapt to metabolic stress by increasing ethanolamine phospholipid synthesis and CTP:ethanolaminephosphate cytidylyltransferase-Pcyt2 activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
18583706 2008 Stimulation of the human CTP:phosphoethanolamine cytidylyltransferase gene by early growth response protein 1.
17612623 2007 Metabolic and molecular aspects of ethanolamine phospholipid biosynthesis: the role of CTP:phosphoethanolamine cytidylyltransferase (Pcyt2).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...