Property Summary

NCBI Gene PubMed Count 6
Grant Count 19
R01 Count 3
Funding $5,692,392.62
PubMed Score 400.69
PubTator Score 14.41

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of glycosylphosphatidylinositol anchored molecule like protein (GML) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISIRINSRELLVY      1 - 70
KNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLG     71 - 140
VSKLLLSFASIIVSNILP                                                        141 - 158
//

Text Mined References (6)

PMID Year Title
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9169150 1997 Genomic structure and chromosomal localization of GML (GPI-anchored molecule-like protein), a gene induced by p53.
8934543 1996 Isolation of a novel GPI-anchored gene specifically regulated by p53; correlation between its expression and anti-cancer drug sensitivity.