Property Summary

NCBI Gene PubMed Count 6
PubMed Score 415.29
PubTator Score 14.41

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (3)

AA Sequence

MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISIRINSRELLVY      1 - 70
KNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLG     71 - 140
VSKLLLSFASIIVSNILP                                                        141 - 158
//

Text Mined References (6)

PMID Year Title