Property Summary

NCBI Gene PubMed Count 19
PubMed Score 48.87
PubTator Score 25.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.97991365651781E-6
medulloblastoma, large-cell 6234 3.96819977411541E-6
atypical teratoid / rhabdoid tumor 4369 4.22622496981648E-6
adult high grade glioma 2148 1.98950299600841E-5
glioblastoma 5572 2.29607927330228E-5
hepatocellular carcinoma 550 4.30770980739488E-5
adrenocortical carcinoma 1427 4.53478214801683E-5
osteosarcoma 7933 5.37186611597829E-5
psoriasis 6685 5.74694718059138E-5
medulloblastoma 1524 6.07805228824852E-5
invasive ductal carcinoma 2950 0.00133439298822522
tuberculosis and treatment for 6 months 686 0.00183700489574791
primitive neuroectodermal tumor 3031 0.00239654823362045
gastric cancer 436 0.0056763419967147
pancreatic carcinoma 567 0.011550645680819
pancreatic cancer 2300 0.0115506456808191
astrocytic glioma 2241 0.0160171300707792
Waldenstrons macroglobulinemia 765 0.0223579857003922
ependymoma 2514 0.024770955447163
pancreatic ductal adenocarcinoma liver metastasis 1795 0.033375517910821
Breast cancer 3099 0.0368650854608382

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.600 0.006
hepatocellular carcinoma 1.500 0.000
pancreatic cancer 1.400 0.012
Waldenstrons macroglobulinemia 1.117 0.022
astrocytic glioma -1.600 0.016
ependymoma -1.800 0.025
psoriasis -1.600 0.000
osteosarcoma -1.885 0.000
glioblastoma -2.200 0.000
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.100 0.002
adrenocortical carcinoma -1.248 0.000
pancreatic ductal adenocarcinoma liver m... -1.117 0.033
tuberculosis and treatment for 6 months -1.800 0.002
Breast cancer 2.300 0.037
adult high grade glioma -1.900 0.000
pancreatic carcinoma 1.400 0.012
invasive ductal carcinoma -1.800 0.001
ovarian cancer -2.000 0.000

Synonym

Accession Q99442 D3DNQ0 O00682 O00729
Symbols HTP1
TP-1
Dtrp1
TLOC1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (11)

PMID Text
24304694 Sec62 overproduction significantly correlates with reduced non-small lung cancer patient survival.
23764425 these studies identify TLOC1 and SKIL as driver genes at 3q26 and more broadly suggest that cooperating genes may be coamplified in other regions with somatic copy number gain.
23287549 Phosphorylation of Sec63 by CK2 enhanced its binding to Sec62
22682366 These results revealed that cyclin B1 and Sec62 may be candidate biomarkers and potential therapeutic targets for HBV-related HCC recurrence after surgery.
22648169 the Sec62-dependent translocation pathway serves as a fail-safe mechanism to ensure efficient secretion of small proteins and provides cells with an opportunity to regulate secretion of small proteins independent of the signal recognition particle pathway
22375059 Silencing the SEC62 gene inhibits post-translational transport of small presecretory proteins into endoplasmic reticulum.
22197383 The results indicate that SEC62 represents a potential candidate oncogene in the amplified 3q region in cases of non-small cell lung cancer.
22190034 HIV-1 gp41 is identified to have a physical interaction with SEC62 homolog (SEC62) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21557272 Our data indicate a crucial function of Sec62 in the response to thapsigargin-induced endoplasmic reticulum stress.
20669223 after silencing of SEC62 the cell migration and the invasive potential of the cells was blocked or at least dramatically reduced while cell viability was hardly affected. SEC62 gene may indeed be considered a target gene in the therapy of various tumors
More...

AA Sequence

MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEA      1 - 70
LFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKE     71 - 140
KKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNEVYVWIYDPVHFKTFVMGLILVIAVIAA    141 - 210
TLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRP    211 - 280
LYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRRED    281 - 350
DRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS                         351 - 399
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24304694 2013 Targeting cell migration and the endoplasmic reticulum stress response with calmodulin antagonists: a clinically tested small molecule phenocopy of SEC62 gene silencing in human tumor cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23764425 2013 Systematic interrogation of 3q26 identifies TLOC1 and SKIL as cancer drivers.
23287549 2013 CK2 phosphorylation of human Sec63 regulates its interaction with Sec62.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22682366 2012 Identification of cyclin B1 and Sec62 as biomarkers for recurrence in patients with HBV-related hepatocellular carcinoma after surgical resection.
22648169 2012 Efficient secretion of small proteins in mammalian cells relies on Sec62-dependent posttranslational translocation.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
22197383 2012 Sec62 bridges the gap from 3q amplification to molecular cell biology in non-small cell lung cancer.
More...