Property Summary

NCBI Gene PubMed Count 21
PubMed Score 52.27
PubTator Score 25.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.248 4.5e-05
adult high grade glioma -1.400 3.5e-03
astrocytic glioma -1.600 1.6e-02
atypical teratoid / rhabdoid tumor -2.100 7.3e-05
Breast cancer 2.300 3.7e-02
ependymoma -1.800 2.5e-02
gastric cancer 1.300 4.5e-03
glioblastoma -1.500 3.4e-06
group 4 medulloblastoma -1.400 1.5e-04
hepatocellular carcinoma 1.300 1.0e-05
invasive ductal carcinoma -1.400 7.4e-04
medulloblastoma, large-cell -1.600 4.6e-05
osteosarcoma -1.885 5.4e-05
ovarian cancer -1.900 4.2e-08
pancreatic cancer 1.200 6.5e-03
pancreatic carcinoma 1.200 6.5e-03
pancreatic ductal adenocarcinoma liver m... -1.117 3.3e-02
primitive neuroectodermal tumor -1.100 2.4e-03
psoriasis -1.600 5.7e-05
tuberculosis -1.400 5.6e-06
Waldenstrons macroglobulinemia 1.117 2.2e-02

Gene RIF (13)

AA Sequence

MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEA      1 - 70
LFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKE     71 - 140
KKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNEVYVWIYDPVHFKTFVMGLILVIAVIAA    141 - 210
TLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRP    211 - 280
LYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRRED    281 - 350
DRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS                         351 - 399
//

Text Mined References (28)

PMID Year Title