Property Summary

NCBI Gene PubMed Count 19
Grant Count 22
R01 Count 18
Funding $1,345,798.75
PubMed Score 48.87
PubTator Score 25.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.600 0.006
hepatocellular carcinoma 1.500 0.000
pancreatic cancer 1.400 0.012
Waldenstrons macroglobulinemia 1.117 0.022
astrocytic glioma -1.600 0.016
ependymoma -1.800 0.025
psoriasis -1.600 0.000
osteosarcoma -1.885 0.000
glioblastoma -2.200 0.000
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.100 0.002
adrenocortical carcinoma -1.248 0.000
pancreatic ductal adenocarcinoma liver m... -1.117 0.033
tuberculosis and treatment for 6 months -1.800 0.002
Breast cancer 2.300 0.037
adult high grade glioma -1.900 0.000
pancreatic carcinoma 1.400 0.012
invasive ductal carcinoma -1.800 0.001
ovarian cancer -2.000 0.000

Gene RIF (11)

PMID Text
24304694 Sec62 overproduction significantly correlates with reduced non-small lung cancer patient survival.
23764425 these studies identify TLOC1 and SKIL as driver genes at 3q26 and more broadly suggest that cooperating genes may be coamplified in other regions with somatic copy number gain.
23287549 Phosphorylation of Sec63 by CK2 enhanced its binding to Sec62
22682366 These results revealed that cyclin B1 and Sec62 may be candidate biomarkers and potential therapeutic targets for HBV-related HCC recurrence after surgery.
22648169 the Sec62-dependent translocation pathway serves as a fail-safe mechanism to ensure efficient secretion of small proteins and provides cells with an opportunity to regulate secretion of small proteins independent of the signal recognition particle pathway
22375059 Silencing the SEC62 gene inhibits post-translational transport of small presecretory proteins into endoplasmic reticulum.
22197383 The results indicate that SEC62 represents a potential candidate oncogene in the amplified 3q region in cases of non-small cell lung cancer.
22190034 HIV-1 gp41 is identified to have a physical interaction with SEC62 homolog (SEC62) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21557272 Our data indicate a crucial function of Sec62 in the response to thapsigargin-induced endoplasmic reticulum stress.
20669223 after silencing of SEC62 the cell migration and the invasive potential of the cells was blocked or at least dramatically reduced while cell viability was hardly affected. SEC62 gene may indeed be considered a target gene in the therapy of various tumors
More...

AA Sequence

MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEA      1 - 70
LFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKE     71 - 140
KKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNEVYVWIYDPVHFKTFVMGLILVIAVIAA    141 - 210
TLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRP    211 - 280
LYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRRED    281 - 350
DRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS                         351 - 399
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24304694 2013 Targeting cell migration and the endoplasmic reticulum stress response with calmodulin antagonists: a clinically tested small molecule phenocopy of SEC62 gene silencing in human tumor cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23764425 2013 Systematic interrogation of 3q26 identifies TLOC1 and SKIL as cancer drivers.
23287549 2013 CK2 phosphorylation of human Sec63 regulates its interaction with Sec62.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22682366 2012 Identification of cyclin B1 and Sec62 as biomarkers for recurrence in patients with HBV-related hepatocellular carcinoma after surgical resection.
22648169 2012 Efficient secretion of small proteins in mammalian cells relies on Sec62-dependent posttranslational translocation.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
22197383 2012 Sec62 bridges the gap from 3q amplification to molecular cell biology in non-small cell lung cancer.
More...