Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.50
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.3e-03

Synonym

Accession Q99440 Q17R65
Symbols aC1
C4orf6

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADTADKTEPECFA      1 - 70
ASWTFDPNPSVTVSGAHSTAVHQ                                                    71 - 93
//

Text Mined References (6)

PMID Year Title