Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.69
PubTator Score 11.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma -2.170 0.000
atypical teratoid / rhabdoid tumor 1.800 0.000
active ulcerative colitis 1.146 0.005
lung carcinoma -2.900 0.000
acute myeloid leukemia 1.800 0.039

Gene RIF (2)

PMID Text
25099617 High Calponin-h2 serum levels are associated with breast cancer.
24285540 h2-Calponin gene expression is further affected by the treatment of cells with Notch inhibitor and activator, suggesting an upstream signaling mechanism.

AA Sequence

MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG      1 - 70
SVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGV     71 - 140
DIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQM    141 - 210
GTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVA    211 - 280
DGAPSGTGDCPDPGEVPEYPPYYQEEAGY                                             281 - 309
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25099617 2014 Calponin-h2: a potential serum marker for the early detection of human breast cancer?
24285540 2014 Mechanoregulation of h2-calponin gene expression and the role of Notch signaling.
23576568 2013 Androgen-responsive serum response factor target genes regulate prostate cancer cell migration.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22403489 2012 Increased fibroblast functionality on CNN2-loaded titania nanotubes.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...