Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.63
PubTator Score 11.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis 1.146 4.9e-03
acute myeloid leukemia 1.800 3.9e-02
atypical teratoid / rhabdoid tumor 1.800 5.8e-06
lung carcinoma -2.900 4.7e-43
osteosarcoma -2.170 2.4e-06
psoriasis -2.100 1.2e-04

Protein-protein Interaction (5)

Gene RIF (3)

AA Sequence

MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG      1 - 70
SVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGV     71 - 140
DIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQM    141 - 210
GTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVA    211 - 280
DGAPSGTGDCPDPGEVPEYPPYYQEEAGY                                             281 - 309
//

Text Mined References (27)

PMID Year Title