Property Summary

NCBI Gene PubMed Count 54
PubMed Score 6.62
PubTator Score 3.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99436 B4E0P1 Q5TBG6 Q96AG8 Q9BWA7
Symbols Z

Gene

PDB

5GJQ   5GJR   5L4G   4R3O   4R67   5A0Q   5LE5   5LEX   5LEY   5LEZ   5LF0   5LF1   5LF3   5LF4   5LF6   5LF7  

Gene RIF (35)

PMID Text
21713324 reduced protein levels in patients with rheumatoid arthritis in association with disease progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20010949 high PSMB7 expression is associated with anthracycline resistance in breast cancer.
19645816 we have identified and characterized a new phosphorylated isoform of the human 20S proteasome b7 subunit and showed its differential expression in tumor vs. normal cell lines
18768472 ZPI functions like other serpins to regulate the activity of FXa but in a manner uniquely dependent on protein Z, procoagulant membranes, and pH
18549262 PSB7, PRDX1, and SRP9 up-regulation as candidate biomarkers of colon cancer is discovered
18462727 A previously unreported sporadic missense mutation within exon 8 is described in a patient with very low protein Z levels.
18378283 Low protein Z levels but not protein Z gene G79A polymorphism are a risk factor for ischemic stroke.
14614829 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14564014 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
More...

AA Sequence

MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVA      1 - 70
DKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAA     71 - 140
LVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDL    141 - 210
GSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS       211 - 277
//

Text Mined References (58)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21713324 2011 Decreased proteinZ levels in patients with rheumatoid arthritis: links with inflammation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20723761 2010 Immunoproteasomes preserve protein homeostasis upon interferon-induced oxidative stress.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...