Property Summary

NCBI Gene PubMed Count 16
PubMed Score 24.12
PubTator Score 14.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
lung cancer 2.600 2.5e-05
adult high grade glioma -2.100 2.4e-03
astrocytic glioma -2.700 3.1e-03
Astrocytoma, Pilocytic -1.300 7.0e-04
Atopic dermatitis 1.600 1.9e-03
atypical teratoid / rhabdoid tumor -1.600 2.3e-02
breast carcinoma 1.300 8.1e-03
Common variable immunodeficiency -1.106 7.1e-03
ependymoma -3.000 2.3e-06
glioblastoma -2.200 8.1e-05
head and neck cancer -1.900 2.8e-02
interstitial cystitis -1.600 7.3e-05
intraductal papillary-mucinous adenoma (... -1.100 4.8e-03
non-small cell lung cancer 1.519 4.3e-06
oligodendroglioma -2.400 8.8e-16
ovarian cancer -4.800 2.5e-16
Pick disease -1.800 1.3e-02
primary Sjogren syndrome 1.500 1.8e-02
primitive neuroectodermal tumor -2.300 3.8e-02
psoriasis 1.100 4.2e-03
sarcoidosis -1.700 2.6e-05

Gene RIF (4)

AA Sequence

MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPGLHNGTKAFLFQDTPRSIKAS      1 - 70
TATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELESSGHRNEVRLHYRSGSHRPHTEV     71 - 140
FPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPSTDLPLGTTFWLGQRNNAHGYFKGIMQDVQL    141 - 210
LVMPQGFIAQCPDLNRTCPTCNDFHGLVQKIMELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKGTT    211 - 280
YREFESWIDGCKNCTCLNGTIQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVY    281 - 350
SSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRA    351 - 420
VCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECITNQ    421 - 490
HNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANVCACPQGFTGPSCETDIDECS    491 - 560
DGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESCEDIDECGTGRHSCANDTICFNLDGGYDCRC    561 - 630
PHGKNCTGDCIHDGKVKHNGQIWVLENDRCSVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQC    631 - 700
LHQNGETLYNSGDTWVQNCQQCRCLQGEVDCWPLPCPDVECEFSILPENECCPRCVTDPCQADTIRNDIT    701 - 770
KTCLDEMNVVRFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL                            771 - 816
//

Text Mined References (17)

PMID Year Title