Property Summary

NCBI Gene PubMed Count 21
PubMed Score 20.93
PubTator Score 13.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.300 1.2e-03
Multiple myeloma 1.451 7.7e-04
ovarian cancer 2.800 1.2e-07
pancreatic cancer 1.100 1.7e-02
psoriasis 1.100 3.5e-04
tuberculosis 1.200 3.1e-09

Gene RIF (11)

AA Sequence

MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQE      1 - 70
DALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQ     71 - 140
QEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNG    141 - 210
KRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI                                        211 - 244
//

Text Mined References (27)

PMID Year Title