Property Summary

NCBI Gene PubMed Count 21
Grant Count 5
R01 Count 4
Funding $423,900
PubMed Score 17.69
PubTator Score 13.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.719 0.000
psoriasis 1.100 0.000
tuberculosis 1.200 0.000
lung cancer 1.300 0.001
ovarian cancer 2.800 0.000
pancreatic cancer 1.100 0.017

Gene RIF (11)

PMID Text
25908846 the role of the human TBCE and TBCB chaperones in alpha-tubulin-beta-tubulin dissociation, was investigated.
25505242 results support a role for MAP1 proteins in promoting efficient retrograde trafficking of HIV-1 by stimulating the formation of stable microtubules and mediating the association of HIV-1 cores with microtubules.
25505242 CKAP1 protein interacts weakly with HIV-1 CA cores in primary human macrophages
22940919 TBCB localizes at spindle and midzone microtubules during mitosis.
22777741 Overexpression of TBCB leads to the decreased localization of p150 to the microtubule network that might result in a functional modulation of this protein complex.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19168853 Study demonstrates that, unlike its counterpart TBCE, TBCB only moderately destabilizes microtubules; neither TBCB abundance nor microtubule organization or densities are altered in giant axonal neuropathy mutant fibroblasts.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19038251 TBCB functions as a microtubule density regulator in microglia during activation, and provide an insight into understanding of mechanisms controlling microtubule reorganization during microglial transition between phenotypes.
More...

AA Sequence

MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQE      1 - 70
DALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQ     71 - 140
QEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNG    141 - 210
KRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI                                        211 - 244
//

Text Mined References (27)

PMID Year Title
25908846 2015 The structure of the complex between ?-tubulin, TBCE and TBCB reveals a tubulin dimer dissociation mechanism.
25505242 2015 Microtubule-associated proteins 1 (MAP1) promote human immunodeficiency virus type I (HIV-1) intracytoplasmic routing to the nucleus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22940919 2013 Autoinhibition of TBCB regulates EB1-mediated microtubule dynamics.
22777741 2012 Tubulin-binding cofactor B is a direct interaction partner of the dynactin subunit p150(Glued).
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...