Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.33
PubTator Score 11.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 9.61456537724178E-15
ovarian cancer 8492 3.61578641127303E-8
psoriasis 6685 2.14708698028778E-5
malignant mesothelioma 3163 3.94608849733757E-4
Atopic dermatitis 944 4.97139944526192E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.6358123397571E-4
subependymal giant cell astrocytoma 2287 0.00259647063512195
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00367014136495805
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00685000651667649
active Crohn's disease 918 0.0132963162412037
adrenocortical carcinoma 1427 0.017759826720965
invasive ductal carcinoma 2950 0.0321076900793116
osteosarcoma 7933 0.036431122764041
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0455273769867773

Expression

Synonym

Accession Q99424 A6NF16 B2R8U5
Symbols BCOX
BRCOX
THCCox
BRCACOX

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA Inparanoid

 MGI Term (1)

Gene RIF (3)

PMID Text
26183823 Results found an ACOX2 variant present in a subset of human breast cancers and associated with improved outcome ER+ tumors suggesting it as a potential novel therapeutic biomarker in ER+ breast tumors.
21343950 Our results suggest that downregulation of ACOX2 is a shared risk factor for PE and CVD.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYF      1 - 70
MTQNERYKAAMRRAFHIRLIARRLGWLEDGRELGYAYRALSGDVALNIHRVFVRALRSLGSEEQIAKWDP     71 - 140
LCKNIQIIATYAQTELGHGTYLQGLETEATYDAATQEFVIHSPTLTATKWWPGDLGRSATHALVQAQLIC    141 - 210
SGARRGMHAFIVPIRSLQDHTPLPGIIIGDIGPKMDFDQTDNGFLQLNHVRVPRENMLSRFAQVLPDGTY    211 - 280
VKLGTAQSNYLPMVVVRVELLSGEILPILQKACVIAMRYSVIRRQSRLRPSDPEAKVLDYQTQQQKLFPQ    281 - 350
LAISYAFHFLAVSLLEFFQHSYTAILNQDFSFLPELHALSTGMKAMMSEFCTQGAEMCRRACGGHGYSKL    351 - 420
SGLPSLVTKLSASCTYEGENTVLYLQVARFLVKSYLQTQMSPGSTPQRSLSPSVAYLTAPDLARCPAQRA    421 - 490
ADFLCPELYTTAWAHVAVRLIKDSVQHLQTLTQSGADQHEAWNQTTVIHLQAAKVHCYYVTVKGFTEALE    491 - 560
KLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFT    561 - 630
DQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL                       631 - 681
//

Text Mined References (15)

PMID Year Title
26183823 2015 Expression of an estrogen-regulated variant transcript of the peroxisomal branched chain fatty acid oxidase ACOX2 in breast carcinomas.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21343950 2011 Identification of ACOX2 as a shared genetic risk factor for preeclampsia and cardiovascular disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
16756494 2006 Biochemistry of mammalian peroxisomes revisited.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...