Property Summary

NCBI Gene PubMed Count 53
PubMed Score 0.00
PubTator Score 132.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 4 medulloblastoma 1875 1.97867333208217E-5
ovarian cancer 8492 8.99592961434584E-5
atypical teratoid / rhabdoid tumor 4369 1.10892155104152E-4
primitive neuroectodermal tumor 3031 1.38716284865627E-4
lung cancer 4473 2.37786374838697E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.23211366296782E-4
adrenocortical carcinoma 1427 4.03883132758014E-4
ductal carcinoma in situ 1745 8.80261887850824E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.40435724391326E-4
diabetes mellitus 1663 0.00174241661245107
invasive ductal carcinoma 2950 0.00198030586370153
osteosarcoma 7933 0.00219370306733563
Breast cancer 3099 0.0215258560780546
ependymoma 2514 0.0499786124609119

Expression

Synonym

Accession Q99418 A8K8P0 Q8IXY9 Q92958
Symbols ARNO
CTS18
PSCD2
SEC7L
PSCD2L
CTS18.1
Sec7p-L
Sec7p-like
cytohesin-2

Gene

PDB

1PBV   1R8M   1R8Q   1R8S   1S9D   4JMI   4JMO   4JWL   4JXH   4L5M   4Z21  

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (26)

PMID Text
27203102 Authors' experiments argue against ARNO being a robust modifier of EGFR catalytic activity.
26378252 Data establish a role for cytohesin-2/ARNO as a regulator of R-Ras and integrin recycling and suggest that ARF-regulated trafficking of R-Ras is required for R-Ras-dependent effects on spreading and adhesion formation.
25736891 The authors show that Shigella flexneri IpgD phosphatase activity is required for recruitment of the ARF6 guanine nucleotide exchange factor (GEF) ARF nucleotide binding site opener (ARNO) to bacterial entry sites.
24618737 inhibiting cytohesins or ARNO as cytoplasmic activators of EGFR and IGF-I in colorectal cancer resulted in anti-proliferation, reduced invasion, decreased migration, and suppressed growth in vivo and in vitro.
24581425 Cytohesin-2 constitutively suppresses platelet dense granule secretion and aggregation by keeping ARF6 in a GTP-bound state
24083777 Phosphorylation of Ser392 of ARNO stabilized the C-terminal alpha-helix via formation of salt bridges between phospho-Ser392 and Arg390, Lys395, and Lys396.
23545718 There is an association between cytohesin-2 expression and overall survival and disease-free survival in patients with hepatocellular carcinoma.
23288846 The N termini of a-subunit isoforms are involved in signaling between vacuolar H+-ATPase (V-ATPase) and cytohesin-2
23255605 Kinetics of interaction between ADP-ribosylation factor-1 (Arf1) and the Sec7 domain of Arno guanine nucleotide exchange factor, modulation by allosteric factors, and the uncompetitive inhibitor brefeldin A
23095975 Arf6/ ARNO signaling mediates phospholipase-D, ERK1/2 and cofilin activation in pancreatic beta-cells.
More...

AA Sequence

MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRK      1 - 70
KFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNL     71 - 140
VQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGL    141 - 210
ERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRR    211 - 280
WFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGN    281 - 350
HMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP                        351 - 400
//

Text Mined References (54)

PMID Year Title
27203102 2016 Lack of Evidence that CYTH2/ARNO Functions as a Direct Intracellular EGFR Activator.
26378252 2015 ARF-GEF cytohesin-2/ARNO regulates R-Ras and ?5-integrin recycling through an EHD1-positive compartment.
25736891 2015 Shigella flexneri regulation of ARF6 activation during bacterial entry via an IpgD-mediated positive feedback loop.
25416956 2014 A proteome-scale map of the human interactome network.
25326380 2014 Arf6 guanine nucleotide exchange factor cytohesin-2 binds to CCDC120 and is transported along neurites to mediate neurite growth.
24618737 2014 Cytohesins/ARNO: the function in colorectal cancer cells.
24581425 2014 Cytohesin-2 phosphorylation by protein kinase C relieves the constitutive suppression of platelet dense granule secretion by ADP-ribosylation factor 6.
24083777 2013 Effect of Ser392 phosphorylation on the structure and dynamics of the polybasic domain of ADP ribosylation factor nucleotide site opener protein: a molecular simulation study.
23545718 2013 Cytohesin-2 as a novel prognostic marker for hepatocellular carcinoma.
23288846 2013 The N termini of a-subunit isoforms are involved in signaling between vacuolar H+-ATPase (V-ATPase) and cytohesin-2.
More...