Property Summary

NCBI Gene PubMed Count 56
PubMed Score 0.00
PubTator Score 132.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.491 4.0e-04
atypical teratoid / rhabdoid tumor 1.600 1.1e-04
Breast cancer 3.600 2.2e-02
diabetes mellitus -1.200 1.7e-03
ductal carcinoma in situ 1.600 8.8e-04
ependymoma 1.300 5.0e-02
group 3 medulloblastoma 1.600 7.9e-04
intraductal papillary-mucinous carcinoma... 1.800 9.4e-04
intraductal papillary-mucinous neoplasm ... 1.500 3.2e-04
invasive ductal carcinoma 1.800 2.0e-03
lung cancer 1.100 2.4e-04
osteosarcoma -1.598 2.2e-03
ovarian cancer 1.400 9.0e-05
primitive neuroectodermal tumor 1.500 1.4e-04

PDB (11)

Gene RIF (27)

AA Sequence

MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRK      1 - 70
KFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNL     71 - 140
VQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGL    141 - 210
ERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRR    211 - 280
WFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGN    281 - 350
HMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP                        351 - 400
//

Text Mined References (57)

PMID Year Title