Property Summary

NCBI Gene PubMed Count 109
Grant Count 303
R01 Count 171
Funding $33,235,199.26
PubMed Score 860.29
PubTator Score 975.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99259 Q49AK1 Q53TQ7 Q9BU91 Q9UHH4
Symbols GAD
SCP
CPSQ1

Gene

PANTHER Protein Class (2)

PDB

2OKJ   3VP6  

Gene RIF (99)

PMID Text
25851180 Gene ransfer of GAD67 by herpes simplex virus vectors prevents HIV gp120/ddC-induced neuropathic pain.
25851180 Neuropathic pain induced by HIV-1 gp120 with ddC is inhibited by overexpression of GAD67 mediated by HSV vector
25660468 This study showed that in female groups, the expression of GABRA5 was generally higher in schizophrenia cases compared to the control.
25647668 The GAD65-independent mechanism for targeting of GAD67 to synaptic vesicles in neurons is not functional in islet beta-cells.
25523979 GAD autoantibodies were associated with risk of developing type 1 diabetes.
25301693 Conversion of GAD autoantibody is associated with patients with presumed type 2 diabetes.
25252306 CNR1, GAD1 and BDNF polymorphisms are associated with male heroin dependence in the Dai population in China.
25072323 These results suggest a link between altered inhibitory mechanisms and synchrony and, therefore point to potential mechanisms via which a disruption in neurodevelopmental processes might lead to pathophysiology associated with schizophrenia.
24950944 Phosphate-activated glutaminase and GAD65/67 concentrations are compared in Alzheimer's disease cerebellum versus normal cerebellum controls
24874453 Deficient Zif268 mRNA expression may contribute to lower cortical GAD67 levels in schizophrenia, suggesting altered cortical GABA synthesis and impaired cognition in schizophrenia.
More...

AA Sequence

MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKER      1 - 70
QSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRSTKVLD     71 - 140
FHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTAN    141 - 210
TNMFTYEIAPVFVLMEQITLKKMREIVGWSSKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVP    211 - 280
KLVLFTSEQSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVY    281 - 350
GAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE    351 - 420
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYL    421 - 490
YAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAPKIKALMMESGTTMVGYQPQG    491 - 560
DKANFFRMVISNPAATQSDIDFLIEEIERLGQDL                                        561 - 594
//

Text Mined References (110)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25851180 2015 Gene Transfer of Glutamic Acid Decarboxylase 67 by Herpes Simplex Virus Vectors Suppresses Neuropathic Pain Induced by Human Immunodeficiency Virus gp120 Combined with ddC in Rats.
25660468 2015 Sex differences in GABAergic gene expression occur in the anterior cingulate cortex in schizophrenia.
25647668 2015 Compartmentalization of GABA synthesis by GAD67 differs between pancreatic beta cells and neurons.
25523979 2015 Autoantibody-defined risk for Type 1 diabetes mellitus in a general population of schoolchildren: results of the Karlsburg Type 1 Diabetes Risk Study after 18 years.
25416956 2014 A proteome-scale map of the human interactome network.
25301693 2015 Positive conversion of GAD autoantibody in patients with presumed type 2 diabetes.
25252306 2014 [Association study of CNR1, GAD1 and BDNF polymorphisms with male heroin dependence in the Dai population in Yunnan].
25072323 2014 Association of aberrant neural synchrony and altered GAD67 expression following exposure to maternal immune activation, a risk factor for schizophrenia.
24950944 2014 Glutamate and GABA-metabolizing enzymes in post-mortem cerebellum in Alzheimer's disease: phosphate-activated glutaminase and glutamic acid decarboxylase.
More...