Property Summary

NCBI Gene PubMed Count 118
PubMed Score 896.32
PubTator Score 975.07

Knowledge Summary


No data available


  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Gout 104 0.0 1.2
Disease Target Count Z-score Confidence
Opiate dependence 29 0.0 5.0
Disease Target Count
Spastic Quadriplegia 42


  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma 1.940 6.6e-03
adult high grade glioma -2.700 4.8e-05
Alzheimer's disease -1.600 4.8e-02
astrocytoma -1.600 2.0e-08
Astrocytoma, Pilocytic -1.300 9.7e-03
atypical teratoid / rhabdoid tumor -4.300 3.9e-05
Down syndrome -1.400 3.3e-02
ependymoma -3.000 4.8e-02
glioblastoma -2.000 2.3e-04
group 3 medulloblastoma -5.400 5.3e-08
intraductal papillary-mucinous carcinoma... 2.100 1.9e-02
intraductal papillary-mucinous neoplasm ... 3.900 1.2e-05
lung cancer 2.400 8.6e-05
lung carcinoma 2.200 2.5e-15
medulloblastoma, large-cell -4.400 3.6e-03
nasopharyngeal carcinoma 2.200 1.9e-04
non primary Sjogren syndrome sicca -1.100 1.2e-02
oligodendroglioma -1.300 8.2e-06
Pick disease -1.800 3.0e-02
primitive neuroectodermal tumor 1.300 5.0e-02

Protein-protein Interaction (2)

Gene RIF (107)

AA Sequence

DKANFFRMVISNPAATQSDIDFLIEEIERLGQDL                                        561 - 594

Text Mined References (119)

PMID Year Title