Property Summary

NCBI Gene PubMed Count 15
PubMed Score 712.28
PubTator Score 34.21

Knowledge Summary

Patent

No data available

Gene RIF (6)

AA Sequence

MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMIRPPYSSYGYE      1 - 70
PMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQ     71 - 140
PFQPQPVQPQPHQPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVD        141 - 206
//

Text Mined References (15)

PMID Year Title