Property Summary

NCBI Gene PubMed Count 54
Grant Count 16
R01 Count 11
Funding $1,241,919.72
PubMed Score 701.80
PubTator Score 189.91

Knowledge Summary

Patent

No data available

Gene RIF (35)

PMID Text
26762641 Full-length amelogenin may have a negative mitogenic impact on human dental pulp stem cells.
26551370 sequencing data showed presence of mutation. Samples showing mutation (43.3%) showed high correlation with caries (80.7%) experience which was statistically significant.
26545753 Studies indicate that a single point mutation (41Pro-->Thr) in the amelogenin gene causes severe dental enamel malformation known as amelogenesis imperfect.
25791822 suggestive overrepresentation of TT genotype of amelogenin marker in cases w/severe erosion when compared to no dentine erosion. Amelogenin also associated with severe erosion in recessive model; TT genotype significantly more frequent in affected group
25122764 Conversion to amelogenin expressing dental epithelial cells involved an up-regulation of the stem cell marker Sox2 and proliferation genes and decreased expression of mesenchymal markers
25117480 silent mutation in exon 4 of AMELX gene. generating and characterizing transgenic animal model, alteration of the ratio and quantity of the developmentally conserved alternative splicing repertoire of AMELX caused defects in enamel matrix mineralization.
24167599 the interaction of amelogenin with Grp78/Bip contributed to cell proliferation, rather than correlate with the osteogenic differentiation
23948316 demonstrate the presence of copy number variations in regions containing 9 of the 13 CODIS(Combined DNA Index System) short tandem repeat(STR) and AMELX/Y loci
23790503 Associations between TFIP11 (p=0.02), ENAM (p=0.00001), and AMELX (p=0.01) could be seen with caries independent of having MIH or genomic DNA copies of Streptococcus mutans detected by real time PCR in the Brazilian sample.
23733431 The 21 non-CODIS STR loci of the Russian ethnic minority group were characterized by high genetic diversity and therefore may be useful for elucidating the population's genetic background, for individual identification.
More...

AA Sequence

MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLS      1 - 70
QQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPM     71 - 140
QPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD                       141 - 191
//

Text Mined References (58)

PMID Year Title
26762641 2016 Full-length amelogenin influences the differentiation of human dental pulp stem cells.
26551370 2015 Association of Amelogenin with High Caries Experience in Indian Children.
26545753 2015 Amelogenin in Enamel Tissue Engineering.
25791822 2015 Enamel formation genes associated with dental erosive wear.
25789606 2015 A secretory kinase complex regulates extracellular protein phosphorylation.
25122764 2014 A pituitary homeobox 2 (Pitx2):microRNA-200a-3p:?-catenin pathway converts mesenchymal cells to amelogenin-expressing dental epithelial cells.
25117480 2014 Alteration of conserved alternative splicing in AMELX causes enamel defects.
24167599 2013 Identification of novel amelogenin-binding proteins by proteomics analysis.
23948316 2013 Characterization of copy number variation in genomic regions containing STR loci using array comparative genomic hybridization.
23790503 2013 Genes expressed in dental enamel development are associated with molar-incisor hypomineralization.
More...