Property Summary

NCBI Gene PubMed Count 55
PubMed Score 694.96
PubTator Score 189.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (36)

AA Sequence

MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLS      1 - 70
QQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPM     71 - 140
QPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD                       141 - 191
//

Text Mined References (59)

PMID Year Title