Property Summary

NCBI Gene PubMed Count 140
PubMed Score 419.76
PubTator Score 275.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 6.2807166532062E-80
nasopharyngeal carcinoma 1056 1.21216789939041E-9
non-small cell lung cancer 2798 9.94031864254738E-7
pancreatic cancer 2300 1.05768765890737E-5
ulcerative colitis 2087 2.0082875999229E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00450913650791632
active Crohn's disease 918 0.0154339568484791
ovarian cancer 8492 0.0187600706034184
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0443253470209788
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Endometrial cancer 32 0.0 1.0
Large intestine cancer 12 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.753 2.4
Disease Target Count
cystic fibrosis 1670

Expression

  Differential Expression (9)

Gene

  Ortholog (2)

Species Source
Mouse OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid

 CSPA Cell Line (2)

Gene RIF (123)

PMID Text
26686060 The most highly up-regulated gene was mucin 4 (MUC4), and its protein product was confirmed to be over-expressed in periodontitis
26673820 High MUC4 expression is associated wit response to chemotherapy in esophageal squamous cell carcinoma.
26526617 authors show for the first time that beta-catenin directly governs MUC4 in pancreatic cancer.
26477488 Transfection of constitutively activated K-rasG12V in pancreatic cancer cells led to the transcriptional upregulation of MUC4 at the transcriptional level by AP-1, MAPK, JNK and NF-kappaB pathways and at the posttranscriptional level by RalB GTPase.
26393880 MUC4 has a role in promoting neural invasion mediated by the axon guidance factor Netrin-1 in pancreatic ductal adenocarcinoma
26035354 HER3/MUC4 oncogenic signaling aggravates the tumorigenic phenotypes of pancreatic cancer cells
25923310 Results show that while MUC4 is highly expressed in the mouse uterus, it is not a major mucin in normal human endometrium. Rather, MUC4 is a potential marker of endometrial adenocarcinoma in a subset of patients.
25686822 High MUC4 expression is associated with pancreatic cancer.
25571874 This epigenome-wide DNA methylation analysis in postmortem hippocampus and prefrontal cortex specimens confirmed MUC4 DNA methylation profiles in major depression.
25531332 NCOA3 upregulates mucin 1 and 4 via transcriptional and post-translational changes in pancreatic cancer.
More...

AA Sequence

MKGARWRRVPWVSLSCLCLCLLPHVVPGTTEDTLITGSKTAAPVTSTGSTTATLEGQSTAASSRTSNQDI      1 - 70
SASSQNHQTKSTETTSKAQTDTLTQMMTSTLFSSPSVHNVMETVTQETAPPDEMTTSFPSSVTNTLMMTS     71 - 140
KTITMTTSTDSTLGNTEETSTAGTESSTPVTSAVSITAGQEGQSRTTSWRTSIQDTSASSQNHWTRSTQT    141 - 210
TRESQTSTLTHRTTSTPSFSPSVHNVTGTVSQKTSPSGETATSSLCSVTNTSMMTSEKITVTTSTGSTLG    211 - 280
NPGETSSVPVTGSLMPVTSAALVTVDPEGQSPATFSRTSTQDTTAFSKNHQTQSVETTRVSQINTLNTLT    281 - 350
PVTTSTVLSSPSGFNPSGTVSQETFPSGETTISSPSSVSNTFLVTSKVFRMPISRDSTLGNTEETSLSVS    351 - 420
GTISAITSKVSTIWWSDTLSTALSPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSPGVSQEIFTLHET    421 - 490
TTWPSSFSSKGHTTWSQTELPSTSTGAATRLVTGNPSTRAAGTIPRVPSKVSAIGEPGEPTTYSSHSTTL    491 - 560
PKTTGAGAQTQWTQETGTTGEALLSSPSYSVIQMIKTATSPSSSPMLDRHTSQQITTAPSTNHSTIHSTS    561 - 630
TSPQESPAVSQRGHTRAPQTTQESQTTRSVSPMTDTKTVTTPGSSFTASGHSPSEIVPQDAPTISAATTF    631 - 700
APAPTGNGHTTQAPTTALQAAPSSHDATLGPSGGTSLSKTGALTLANSVVSTPGGPEGQWTSASASTSPD    701 - 770
TAAAMTHTHQAESTEASGQTQTSEPASSGSRTTSAGTATPSSSGASGTTPSGSEGISTSGETTRFSSNPS    771 - 840
RDSHTTQSTTELLSASASHGAIPVSTGMASSIVPGTFHPTLSEASTAGRPTGQSSPTSPSASPQETAAIS    841 - 910
RMAQTQRTGTSRGSDTISLASQATDTFSTVPPTPPSITSSGLTSPQTQTHTLSPSGSGKTFTTALISNAT    911 - 980
PLPVTSTSSASTGHATPLAVSSATSASTVSSDSPLKMETSGMTTPSLKTDGGRRTATSPPPTTSQTIIST    981 - 1050
IPSTAMHTRSTAAPIPILPERGVSLFPYGAGAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDN   1051 - 1120
GQIIFPESDYQIFSYPNPLPTGFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETFYGEHSLLVQQAESW   1121 - 1190
IRKMTNNGGYKARWALKVTWVNAHAYPAQWTLGSNTYQAILSTDGSRSYALFLYQSGGMQWDVAQRSGNP   1191 - 1260
VLMGFSSGDGYFENSPLMSQPVWERYRPDRFLNSNSGLQGLQFYRLHREERPNYRLECLQWLKSQPRWPS   1261 - 1330
WGWNQVSCPCSWQQGRRDLRFQPVSIGRWGLGSRQLCSFTSWRGGVCCSYGPWGEFREGWHVQRPWQLAQ   1331 - 1400
ELEPQSWCCRWNDKPYLCALYQQRRPHVGCATYRPPQPAWMFGDPHITTLDGVSYTFNGLGDFLLVGAQD   1401 - 1470
GNSSFLLQGRTAQTGSAQATNFIAFAAQYRSSSLGPVTVQWLLEPHDAIRVLLDNQTVTFQPDHEDGGGQ   1471 - 1540
ETFNATGVLLSRNGSEVSASFDGWATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNG   1541 - 1610
STIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGDSSCIYDT   1611 - 1680
LALRNASIGLHTREVSKNYEQANATLNQYPPSINGGRVIEAYKGQTTLIQYTSNAEDANFTLRDSCTDLE   1681 - 1750
LFENGTLLWTPKSLEPFTLEILARSAKIGLASALQPRTVVCHCNAESQCLYNQTSRVGNSSLEVAGCKCD   1751 - 1820
GGTFGRYCEGSEDACEEPCFPSVHCVPGKGCEACPPNLTGDGRHCAALGSSFLCQNQSCPVNYCYNQGHC   1821 - 1890
YISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNLELPLRVIQLLLSEEENASMAEVNASVAYRLGTLD   1891 - 1960
MRAFLRNSQVERIDSAAPASGSPIQHWMVISEFQYRPRGPVIDFLNNQLLAAVVEAFLYHVPRRSEEPRN   1961 - 2030
DVVFQPISGEDVRDVTALNVSTLKAYFRCDGYKGYDLVYSPQSGFTCVSPCSRGYCDHGGQCQHLPSGPR   2031 - 2100
CSCVSFSIYTAWGEHCEHLSMKLDAFFGIFFGALGGLLLLGVGTFVVLRFWGCSGARFSYFLNSAEALP    2101 - 2169
//

Text Mined References (142)

PMID Year Title
26686060 2015 Transcriptome analysis reveals mucin 4 to be highly associated with periodontitis and identifies pleckstrin as a link to systemic diseases.
26673820 2016 Possible prediction of the response of esophageal squamous cell carcinoma to neoadjuvant chemotherapy based on gene expression profiling.
26526617 2016 The canonical Wnt pathway regulates the metastasis-promoting mucin MUC4 in pancreatic ductal adenocarcinoma.
26477488 2015 The mucin MUC4 is a transcriptional and post-transcriptional target of K-ras oncogene in pancreatic cancer. Implication of MAPK/AP-1, NF-?B and RalB signaling pathways.
26393880 2015 MUC4-promoted neural invasion is mediated by the axon guidance factor Netrin-1 in PDAC.
26035354 2015 Novel HER3/MUC4 oncogenic signaling aggravates the tumorigenic phenotypes of pancreatic cancer cells.
25923310 2015 Cytokine stimulation of MUC4 expression in human female reproductive tissue carcinoma cell lines and endometrial cancer.
25686822 2015 Targeting EGF-receptor(s) - STAT1 axis attenuates tumor growth and metastasis through downregulation of MUC4 mucin in human pancreatic cancer.
25571874 2015 Aberrant NMDA receptor DNA methylation detected by epigenome-wide analysis of hippocampus and prefrontal cortex in major depression.
25531332 2015 NCOA3-mediated upregulation of mucin expression via transcriptional and post-translational changes during the development of pancreatic cancer.
More...