Property Summary

NCBI Gene PubMed Count 56
PubMed Score 159.77
PubTator Score 99.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Craniosynostoses 16 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 0.7
Disease Target Count Z-score Confidence
Acrocephalosyndactylia 17 3.405 1.7
Photokeratitis 1 3.405 1.7
Cancer 2499 3.379 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.700 5.3e-05
astrocytic glioma 2.600 1.6e-02
Astrocytoma, Pilocytic 2.100 9.8e-10
atypical teratoid / rhabdoid tumor 1.200 2.9e-03
Breast cancer -1.400 3.7e-17
Down syndrome 1.400 4.2e-04
ependymoma 2.400 2.7e-02
glioblastoma 1.700 8.7e-09
juvenile dermatomyositis 1.168 1.4e-11
medulloblastoma 1.400 6.3e-06
medulloblastoma, large-cell 1.100 1.0e-02
oligodendroglioma 2.800 6.5e-03
ovarian cancer -1.400 7.0e-04
primitive neuroectodermal tumor 1.600 3.3e-04
psoriasis -1.100 4.2e-12

 OMIM Phenotype (1)

Gene RIF (26)

AA Sequence

MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSWGTSGQPSPSY      1 - 70
DSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLYSRDTGLPGCQSSLLRQDLGL     71 - 140
GSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALDPLQAKKVRKVPPGLPSSVYAPSPNSDDFNRESPS    141 - 210
YPSPKPPTSMFASTFFMQDGTHNSSDLWSSSNGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPH    211 - 280
SVSPTDINTSLPPMSSFHRGSTSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPD    281 - 350
HTSSSFPSNPSTPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLQSRMEDRLDRLDDAIHVLRNHAVG    351 - 420
PSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSSLVASSRSASMVGTHREDSVSLNGNHSVLSSTVTTS    421 - 490
STDLNHKTQENYRGGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSST    491 - 560
NEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSL    561 - 630
EQQVRERNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSETTNPMGHM                      631 - 682
//

Text Mined References (74)

PMID Year Title