Property Summary

NCBI Gene PubMed Count 168
PubMed Score 1419.38
PubTator Score 442.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
interstitial cystitis 1.100 4.5e-03
Breast cancer 1.300 1.4e-02
chronic rhinosinusitis -1.266 2.7e-02
cystic fibrosis -1.173 3.2e-05
diabetes mellitus -1.800 3.7e-02
gastric cancer -1.900 5.9e-03
hepatocellular carcinoma -2.800 5.1e-06
lung adenocarcinoma -1.500 2.7e-08
lung cancer -3.700 2.4e-06
lung carcinoma -2.300 1.4e-11
malignant mesothelioma 2.400 1.2e-08
medulloblastoma, large-cell -1.200 1.4e-04
mucosa-associated lymphoid tissue lympho... 1.608 1.2e-02
non-small cell lung cancer -2.087 4.7e-14
pituitary cancer -1.500 6.1e-03
psoriasis 1.200 9.1e-04
ulcerative colitis 1.600 9.1e-03

Protein-protein Interaction (2)

Gene RIF (137)

AA Sequence

MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLD      1 - 70
LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG     71 - 140
ERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH      141 - 208
//

Text Mined References (172)

PMID Year Title