Property Summary

NCBI Gene PubMed Count 156
Grant Count 446
R01 Count 264
Funding $44,408,399.43
PubMed Score 1347.86
PubTator Score 442.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer -1.900 0.006
hepatocellular carcinoma -2.800 0.000
malignant mesothelioma 2.500 0.000
psoriasis 1.800 0.000
cystic fibrosis 1.300 0.026
medulloblastoma, large-cell -1.200 0.000
non-small cell lung cancer -2.087 0.000
lung cancer -4.300 0.000
diabetes mellitus -1.800 0.037
interstitial cystitis 1.100 0.004
lung adenocarcinoma -1.816 0.000
Breast cancer 1.300 0.014
lung carcinoma -2.300 0.000
mucosa-associated lymphoid tissue lympho... 1.608 0.012
ulcerative colitis 1.600 0.009
pituitary cancer -1.500 0.006
chronic rhinosinusitis -1.266 0.027

Synonym

Accession Q99075 B2R821
Symbols DTR
DTS
DTSF
HEGFL

Gene

PANTHER Protein Class (2)

PDB

1XDT   2M8S  

Gene RIF (125)

PMID Text
25717241 Serum sHB-EGF is closely correlated with advanced stage gastric cancer and can be a promising serological biomarker for GC.
25589361 Data suggest that placental expression of HBEGF, EGF (epidermal GF), and TGFA (transforming GF alpha) is down-regulated in pre-eclampsia as compared to normal term birth; each growth factor blocks cell death/apoptosis of cytotrophoblast cell line.
25517307 Studies indicate that heparin-binding EGF-like growth factor (HB-EGF) is a therapeutic target in some types of cancers.
25510766 Urinary levels of NGF and HB-EGF may be potential biomarkers for evaluating outcome of overactive bladder syndrome treatment.
25359857 Suggest high levels of HB-EGF contribute to carotid plaque stabilization and reduce the incidence of acute coronary events.
25201063 MiR-212 exerts suppressive effect on SKOV3 ovarian cancer cells through targeting HBEGF.
25138066 the relative expression of hyalurosome (CD44, HAS3, HB-EGF) genes was found to be reduced in patients prior to topical treatment and to be notably increased following treatment.
24828490 HB-EGF is a biomarker for LPA1 receptor activation in human breast and prostate cancers.
24346967 Knockdown of HSP27 by shRNA decreased HB-EGF plus CXCL5-mediated tumor spheroid formation in a three-dimensional culture system, suggesting that AKT/HSP27 was required for HB-EGF/CXCL5-mediated cancer progression
24116709 studies suggest disintegrin and metalloproteinase domain-containing protein 12(ADAM 12S) and heparin-binding epidermal growth factor-like growth factor(HB-EGF) are involved in cellular plasticity resulting in production of brown adipose tissue-like cells
More...

AA Sequence

MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLD      1 - 70
LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG     71 - 140
ERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH      141 - 208
//

Text Mined References (160)

PMID Year Title
25717241 2015 Clinical significance and usefulness of soluble heparin binding-epidermal growth factor in gastric cancer.
25589361 2015 Reduced expression of the epidermal growth factor signaling system in preeclampsia.
25517307 2014 Effect of antigen-dependent clearance on pharmacokinetics of anti-heparin-binding EGF-like growth factor (HB-EGF) monoclonal antibody.
25510766 2015 NGF and HB-EGF: potential biomarkers that reflect the effects of fesoterodine in patients with overactive bladder syndrome.
25359857 2015 High plasma levels of heparin-binding epidermal growth factor are associated with a more stable plaque phenotype and reduced incidence of coronary events.
25201063 2014 MiR-212 exerts suppressive effect on SKOV3 ovarian cancer cells through targeting HBEGF.
25138066 2014 Hyalurosome gene regulation and dose-dependent restoration of skin atrophy by retinaldehyde and defined-size hyaluronate fragments in dermatoporosis.
24828490 2014 Identification of heparin-binding EGF-like growth factor (HB-EGF) as a biomarker for lysophosphatidic acid receptor type 1 (LPA1) activation in human breast and prostate cancers.
24346967 2014 Synergistic effect of lung tumor-associated dendritic cell-derived HB-EGF and CXCL5 on cancer progression.
24116709 2013 Cellular reprogramming into a brown adipose tissue-like phenotype by co-expression of HB-EGF and ADAM 12S.
More...