Property Summary

NCBI Gene PubMed Count 105
Grant Count 77
R01 Count 41
Funding $4,294,703.21
PubMed Score 172.75
PubTator Score 253.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -3.527 0.000
tuberculosis 1.100 0.000
non-small cell lung cancer -1.986 0.000
lung cancer -1.500 0.001
interstitial cystitis 1.200 0.005
lung adenocarcinoma -1.072 0.000
lung carcinoma -2.700 0.000
ulcerative colitis 1.800 0.001
psoriasis 1.100 0.000

Synonym

Accession Q99062 G-CSF receptor
Symbols SCN7
CD114
GCSFR

Gene

PDB

2D9Q   1AZ7  

Gene RIF (70)

PMID Text
26956865 CSF3R mutations, mechanisms of mutations, and their contributions to the myeloid malignancies (Review)
26475333 The Colony-Stimulating Factor 3 Receptor T640N Mutation Is Oncogenic, Sensitive to JAK Inhibition, and Mimics T618I
26324699 CSF3R mutations are associated with congenital neutropenia.
25865944 A de novo CSF3R mutation was associated with the transformation of myeloproliferative neoplasm to atypical chronic myeloproliferative leukemia.
25858548 No CSF3R mutations were found in cases of MDS, JMML or ET. The only mutation found in the CALR gene was a frameshift (p.L367 fs) in one ET patient.
25850813 The SETBP1 and ASXL1 mutations have pathogenetic roles in CSF3R-mutated chronic neutrophilic leukemia.
25730818 The leukemogenic potential of G-CSFRIV is associated with the Stat5-dependent dysregulation of miR-155 and the target genes of this miRNA.
25708716 CSF3R polymorphisms are associated with chronic neutrophilic leukemia.
25666388 In conclusion, rhCSF3 can promote melanocyte proliferation through CSF3R without affecting tyrosinase activity
25533830 the incorporation of CSF3R mutation testing can be a useful point-of-care diagnostic to evaluate the presence of a clonal myeloid disorder, as well as providing the potential for genetically informed therapy.
More...

AA Sequence

MARLGNCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQ      1 - 70
PGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMNLTTSSL     71 - 140
ICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALG    141 - 210
TSMSPQLCLDPMDVVKLEPPMLRTMDPSPEAAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWA    211 - 280
LVGPLPLEALQYELCGLLPATAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPR    281 - 350
TVQLFWKPVPLEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT    351 - 420
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRMEQNGRATGFLL    421 - 490
KENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGKTWAQLEWVPEPPELGKSPLT    491 - 560
HYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHLMAASQAGATNSTVLTLMTLTPEGSELHIIL    561 - 630
GLFGLLLLLTCLCGTAWLCCSPNRKNPLWPSVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLE    631 - 700
EDEKKPVPWESHNSSETCGLPTLVQTYVLQGDPRAVSTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRC    701 - 770
DSTQPLLAGLTPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLNFPLLQGIRVHGMEALGSF        771 - 836
//

Text Mined References (108)

PMID Year Title
26956865 2016 Colony Stimulating Factor 3 Mutations and Myeloid Malignancies.
26475333 2016 The Colony-Stimulating Factor 3 Receptor T640N Mutation Is Oncogenic, Sensitive to JAK Inhibition, and Mimics T618I.
26324699 2015 GM-CSF stimulates granulopoiesis in a congenital neutropenia patient with loss-of-function biallelic heterozygous CSF3R mutations.
25865944 2015 De novo CSF3R mutation associated with transformation of myeloproliferative neoplasm to atypical CML.
25858548 2015 CSF3R and CALR mutations in paediatric myeloid disorders and the association of CSF3R mutations with translocations, including t(8; 21).
25850813 2015 ASXL1 mutations are frequent and prognostically detrimental in CSF3R-mutated chronic neutrophilic leukemia.
25730818 2015 miR-155 is associated with the leukemogenic potential of the class IV granulocyte colony-stimulating factor receptor in CD34? progenitor cells.
25708716 2015 Colony-stimulating factor-3 receptor, watch out for polymorphisms.
25666388 2015 rhCSF3 accelerates the proliferation of human melanocytes in culture through binding CSF3R and the expression of CSF3R transcripts.
25533830 2014 Current strategies in the diagnosis and management of chronic neutrophilic leukemia.
More...