Property Summary

NCBI Gene PubMed Count 25
PubMed Score 21.58
PubTator Score 24.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung cancer 4,466

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.800 0.001

Synonym

Accession Q96TC7 A9UMZ9 B3KRR3 Q6ZWE9 Q96H23 Q96SD6 Q9H6G1 Q9NVQ6 RMD-3
Symbols RMD3
RMD-3
FAM82C
FAM82A2
ptpip51

Gene

Gene RIF (14)

PMID Text
25862004 High PTPIP51 expression is associated with glioblastoma.
24501773 PTPIP51 is regulated by its phosphorylation status combined with a thereby induced subcellular redistribution.
22544307 The presented data confirms a tyrosine phosphorylation-dependent interaction of PTPIP51 with 14-3-3beta and Raf-1 in vivo and a tyrosine-dependent interaction profile with DAGKalpha and PKA.
21972092 In glioblastoma PTPIP51 expression increases with the grade of malignancy and PTPIP51 interacts in situ with 14-3-3ss and PTP1B.
21513978 PTPIP51 is phosphorylated by Lyn and c-Src kinases lacking dephosphorylation by PTP1B in acute myeloid leukemia.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20627780 PTPIP51 expression was restricted to myeloid precursor cells undergoing differentiation. In blood cells therefore, PTPIP51 expression is restricted to differentiating and mature neutrophil granulocytes.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19691131 The promoter methylation status of PTPIP51 seems to influence the expression of PTPIP51, which was seen as elevated in the prostate carcinoma.
19124842 The results clearly point toward a strong association between PTPIP51 expression and differentiation in human muscle cells.
More...

AA Sequence

MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVP      1 - 70
GGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGEVRCHMEENQRVARRR     71 - 140
RFPFVRERSDSTGSSSVYFTASSGATFTDAESEGGYTTANAESDNERDSDKESEDGEDEVSCETVKMGRK    141 - 210
DSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRL    211 - 280
ARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKE    281 - 350
HVDKAIALQPENPMAHFLLGRWCYQVSHLSWLEKKTATALLESPLSATVEDALQSFLKAEELQPGFSKAG    351 - 420
RVYISKCYRELGKNSEARWWMKLALELPDVTKEDLAIQKDLEELEVILRD                        421 - 470
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25862004 2015 PTPIP51 levels in glioblastoma cells depend on inhibition of the EGF-receptor.
24501773 2014 The known interactome of PTPIP51 in HaCaT cells—inhibition of kinases and receptors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22544307 2012 PTPIP51 in protein interactions: regulation and in situ interacting partners.
22131369 2012 VAPB interacts with the mitochondrial protein PTPIP51 to regulate calcium homeostasis.
21972092 2011 PTPIP51, a positive modulator of the MAPK/Erk pathway, is upregulated in glioblastoma and interacts with 14-3-3? and PTP1B in situ.
21513978 2011 PTPIP51 is phosphorylated by Lyn and c-Src kinases lacking dephosphorylation by PTP1B in acute myeloid leukemia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...