Property Summary

NCBI Gene PubMed Count 25
PubMed Score 24.21
PubTator Score 24.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4740 1.2e-03

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.800 1.2e-03

Gene RIF (14)

AA Sequence

MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVP      1 - 70
GGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGEVRCHMEENQRVARRR     71 - 140
RFPFVRERSDSTGSSSVYFTASSGATFTDAESEGGYTTANAESDNERDSDKESEDGEDEVSCETVKMGRK    141 - 210
DSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRL    211 - 280
ARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKE    281 - 350
HVDKAIALQPENPMAHFLLGRWCYQVSHLSWLEKKTATALLESPLSATVEDALQSFLKAEELQPGFSKAG    351 - 420
RVYISKCYRELGKNSEARWWMKLALELPDVTKEDLAIQKDLEELEVILRD                        421 - 470
//

Text Mined References (39)

PMID Year Title