Property Summary

NCBI Gene PubMed Count 16
PubMed Score 321.43
PubTator Score 71.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 5.21532276818743E-8
medulloblastoma 1524 3.04320225465511E-6
Pick disease 1893 6.22851464527197E-6
atypical teratoid/rhabdoid tumor 1095 1.97365005264952E-5
psoriasis 6685 2.50584894699612E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00292417138223281
ovarian cancer 8492 0.00416713008697485
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00529273829327367
Waldenstrons macroglobulinemia 765 0.00572695560368108
Rheumatoid Arthritis 1171 0.0117755752171079
Multiple myeloma 1328 0.016813709434196
pituitary cancer 1972 0.0240053758161217
glioblastoma 5572 0.0302667532219905
Alzheimer's disease 644 0.0323890804287422
invasive ductal carcinoma 2950 0.0329403225208144
spina bifida 1064 0.035817889435841
Breast cancer 3099 0.0480814508259585
Disease Target Count Z-score Confidence
Optic atrophy 43 4.349 2.2
Paraplegia 71 3.264 1.6

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.012
Waldenstrons macroglobulinemia 1.142 0.006
Multiple myeloma 1.211 0.017
psoriasis 2.500 0.000
osteosarcoma 3.216 0.000
medulloblastoma 1.100 0.000
glioblastoma 1.100 0.030
intraductal papillary-mucinous adenoma (... 1.100 0.005
intraductal papillary-mucinous carcinoma... 1.200 0.003
Breast cancer 2.400 0.048
atypical teratoid/rhabdoid tumor 1.100 0.000
spina bifida -1.783 0.036
Alzheimer's disease 1.200 0.032
Pick disease 2.100 0.000
invasive ductal carcinoma 1.100 0.033
ovarian cancer 2.000 0.004
pituitary cancer -1.100 0.024

Synonym

Accession Q96TA2 B4DNM1 D3DRV8 D3DRV9 Q5T8D9 Q9H1Q0 Q9UMR9
Symbols FTSH
MEG4
PAMP
YME1L

Gene

PANTHER Protein Class (3)

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid
C. elegans EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
25433032 YME1L degradation reduces mitochondrial proteolytic capacity during oxidative stress.Loss of YME1L compromises the regulation of mitochondrial inner membrane proteostasis.
22262461 Results reveal a crucial role for YME1L in the maintenance of mitochondrial inner-membrane proteostasis and in the proteolytic regulation of respiratory chain biogenesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFSLSSTVQPQVTVPLSHLINAFHTPKNTSVSLSGVSVSQNQHRDVVPEHEAPSSECMFSDFLTKLNIVS      1 - 70
IGKGKIFEGYRSMFMEPAKRMKKSLDTTDNWHIRPEPFSLSIPPSLNLRDLGLSELKIGQIDQLVENLLP     71 - 140
GFCKGKNISSHWHTSHVSAQSFFENKYGNLDIFSTLRSSCLYRHHSRALQSICSDLQYWPVFIQSRGFKT    141 - 210
LKSRTRRLQSTSERLAETQNIAPSFVKGFLLRDRGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQ    211 - 280
ALTQKTNDSLRRTRLILFVLLLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGVEEAKQE    281 - 350
LQEVVEFLKNPQKFTILGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGASRI    351 - 420
RNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNEGVIIIGATNFPEALDN    421 - 490
ALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVNQAALKAAVD    491 - 560
GKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGH    561 - 630
VSLLPENDRWNETRAQLLAQMDVSMGGRVAEELIFGTDHITTGASSDFDNATKIAKRMVTKFGMSEKLGV    631 - 700
MTYSDTGKLSPETQSAIEQEIRILLRDSYERAKHILKTHAKEHKNLAEALLTYETLDAKEIQIVLEGKKL    701 - 770
EVR                                                                       771 - 773
//

Text Mined References (20)

PMID Year Title
27495975 2016 Homozygous YME1L1 mutation causes mitochondriopathy with optic atrophy and mitochondrial network fragmentation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25433032 2015 YME1L degradation reduces mitochondrial proteolytic capacity during oxidative stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22262461 2012 YME1L controls the accumulation of respiratory chain subunits and is required for apoptotic resistance, cristae morphogenesis, and cell proliferation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
18076378 2008 Metalloprotease-mediated OPA1 processing is modulated by the mitochondrial membrane potential.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...