Property Summary

NCBI Gene PubMed Count 16
Grant Count 11
R01 Count 9
Funding $2,065,036.33
PubMed Score 321.43
PubTator Score 71.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.012
Waldenstrons macroglobulinemia 1.142 0.006
Multiple myeloma 1.211 0.017
psoriasis 2.500 0.000
osteosarcoma 3.216 0.000
medulloblastoma 1.100 0.000
glioblastoma 1.100 0.030
intraductal papillary-mucinous adenoma (... 1.100 0.005
intraductal papillary-mucinous carcinoma... 1.200 0.003
Breast cancer 2.400 0.048
atypical teratoid/rhabdoid tumor 1.100 0.000
spina bifida -1.783 0.036
Alzheimer's disease 1.200 0.032
Pick disease 2.100 0.000
invasive ductal carcinoma 1.100 0.033
ovarian cancer 2.000 0.004
pituitary cancer -1.100 0.024

Gene RIF (4)

PMID Text
25433032 YME1L degradation reduces mitochondrial proteolytic capacity during oxidative stress.Loss of YME1L compromises the regulation of mitochondrial inner membrane proteostasis.
22262461 Results reveal a crucial role for YME1L in the maintenance of mitochondrial inner-membrane proteostasis and in the proteolytic regulation of respiratory chain biogenesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFSLSSTVQPQVTVPLSHLINAFHTPKNTSVSLSGVSVSQNQHRDVVPEHEAPSSECMFSDFLTKLNIVS      1 - 70
IGKGKIFEGYRSMFMEPAKRMKKSLDTTDNWHIRPEPFSLSIPPSLNLRDLGLSELKIGQIDQLVENLLP     71 - 140
GFCKGKNISSHWHTSHVSAQSFFENKYGNLDIFSTLRSSCLYRHHSRALQSICSDLQYWPVFIQSRGFKT    141 - 210
LKSRTRRLQSTSERLAETQNIAPSFVKGFLLRDRGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQ    211 - 280
ALTQKTNDSLRRTRLILFVLLLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGVEEAKQE    281 - 350
LQEVVEFLKNPQKFTILGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGASRI    351 - 420
RNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNEGVIIIGATNFPEALDN    421 - 490
ALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVNQAALKAAVD    491 - 560
GKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGH    561 - 630
VSLLPENDRWNETRAQLLAQMDVSMGGRVAEELIFGTDHITTGASSDFDNATKIAKRMVTKFGMSEKLGV    631 - 700
MTYSDTGKLSPETQSAIEQEIRILLRDSYERAKHILKTHAKEHKNLAEALLTYETLDAKEIQIVLEGKKL    701 - 770
EVR                                                                       771 - 773
//

Text Mined References (20)

PMID Year Title
27495975 2016 Homozygous YME1L1 mutation causes mitochondriopathy with optic atrophy and mitochondrial network fragmentation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25433032 2015 YME1L degradation reduces mitochondrial proteolytic capacity during oxidative stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22262461 2012 YME1L controls the accumulation of respiratory chain subunits and is required for apoptotic resistance, cristae morphogenesis, and cell proliferation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19946888 2010 Defining the membrane proteome of NK cells.
18076378 2008 Metalloprotease-mediated OPA1 processing is modulated by the mitochondrial membrane potential.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...