Property Summary

NCBI Gene PubMed Count 20
PubMed Score 268.02
PubTator Score 71.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Alzheimer's disease 1.200 3.2e-02
atypical teratoid/rhabdoid tumor 1.100 2.0e-05
Breast cancer 2.400 4.8e-02
glioblastoma 1.100 3.0e-02
group 4 medulloblastoma 1.100 4.2e-03
intraductal papillary-mucinous adenoma (... 1.100 5.3e-03
intraductal papillary-mucinous carcinoma... 1.200 2.9e-03
invasive ductal carcinoma 1.100 3.3e-02
Multiple myeloma 1.211 1.7e-02
osteosarcoma 1.776 1.4e-05
ovarian cancer -1.100 4.9e-03
Pick disease 2.100 6.2e-06
pituitary cancer -1.100 2.4e-02
psoriasis 2.100 1.7e-05
Rheumatoid arthritis 1.600 1.2e-02
spina bifida -1.783 3.6e-02
Waldenstrons macroglobulinemia 1.142 5.7e-03

Gene RIF (7)

AA Sequence

MFSLSSTVQPQVTVPLSHLINAFHTPKNTSVSLSGVSVSQNQHRDVVPEHEAPSSECMFSDFLTKLNIVS      1 - 70
IGKGKIFEGYRSMFMEPAKRMKKSLDTTDNWHIRPEPFSLSIPPSLNLRDLGLSELKIGQIDQLVENLLP     71 - 140
GFCKGKNISSHWHTSHVSAQSFFENKYGNLDIFSTLRSSCLYRHHSRALQSICSDLQYWPVFIQSRGFKT    141 - 210
LKSRTRRLQSTSERLAETQNIAPSFVKGFLLRDRGSDVESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQ    211 - 280
ALTQKTNDSLRRTRLILFVLLLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGVEEAKQE    281 - 350
LQEVVEFLKNPQKFTILGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGASRI    351 - 420
RNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNEGVIIIGATNFPEALDN    421 - 490
ALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVNQAALKAAVD    491 - 560
GKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGH    561 - 630
VSLLPENDRWNETRAQLLAQMDVSMGGRVAEELIFGTDHITTGASSDFDNATKIAKRMVTKFGMSEKLGV    631 - 700
MTYSDTGKLSPETQSAIEQEIRILLRDSYERAKHILKTHAKEHKNLAEALLTYETLDAKEIQIVLEGKKL    701 - 770
EVR                                                                       771 - 773
//

Text Mined References (24)

PMID Year Title