Property Summary

NCBI Gene PubMed Count 14
Grant Count 21
R01 Count 11
Funding $2,325,044.43
PubMed Score 4.02
PubTator Score 29.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.456 0.003
glioblastoma 1.300 0.012
breast carcinoma 1.700 0.044
posterior fossa group A ependymoma 1.100 0.000
subependymal giant cell astrocytoma 1.549 0.015
ovarian cancer 1.100 0.000

Gene RIF (3)

PMID Text
26721396 activated EGFR phosphorylates the Y593 residue of the protein known as family with sequence similarity 129, member B (FAM129B), which is overexpressed in many types of human cancer.
21148485 The rapid induction of apoptosis in FAM129B knockdown cells was reversed by co-transfection with recombinant FAM129B, indicating that its effect on apoptosis was specific.
19362540 Phosphorylation of FAM129B has a role in controlling melanoma cell invasion.

AA Sequence

MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIV      1 - 70
FSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLP     71 - 140
GTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFT    141 - 210
DAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVY    211 - 280
EQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEAL    281 - 350
MVPTSQGFTEVRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQR    351 - 420
FDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRVLERVLKKYDYDSSSVRKR    421 - 490
FFREALLQISIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEVVLQTVMKDILQAVKEAAVQR    491 - 560
KHNLYRDSMVMHNSDPNLHLLAEGAPIDWGEEYSNSGGGGSPSPSTPESATLSEKRRRAKQVVSVVQDEE    561 - 630
VGLPFEASPESPPPASPDGVTEIRGLLAQGLRPESPPPAGPLLNGAPAGESPQPKAAPEASSPPASPLQH    631 - 700
LLPGKAVDLGPPKPSDQETGEQVSSPSSHPALHTTTEDSAGVQTEF                            701 - 746
//

Text Mined References (26)

PMID Year Title
26721396 2016 EGFR phosphorylates FAM129B to promote Ras activation.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21148485 2011 FAM129B/MINERVA, a novel adherens junction-associated protein, suppresses apoptosis in HeLa cells.
More...