Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.02
PubTator Score 29.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Idiopathic scoliosis 31 3.386 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.700 4.4e-02
glioblastoma 1.300 1.2e-02
osteosarcoma 1.456 3.2e-03
ovarian cancer 1.100 5.3e-05
posterior fossa group A ependymoma 1.100 3.4e-06
subependymal giant cell astrocytoma 1.549 1.5e-02

Gene RIF (3)

AA Sequence

MGDVLSTHLDDARRQHIAEKTGKILTEFLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIV      1 - 70
FSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSVDQYLELIGNSLP     71 - 140
GTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFT    141 - 210
DAIRMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVY    211 - 280
EQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEAL    281 - 350
MVPTSQGFTEVRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSRLAYHPLKMQSCYEKMESLRLDGLQQR    351 - 420
FDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRVLERVLKKYDYDSSSVRKR    421 - 490
FFREALLQISIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEVVLQTVMKDILQAVKEAAVQR    491 - 560
KHNLYRDSMVMHNSDPNLHLLAEGAPIDWGEEYSNSGGGGSPSPSTPESATLSEKRRRAKQVVSVVQDEE    561 - 630
VGLPFEASPESPPPASPDGVTEIRGLLAQGLRPESPPPAGPLLNGAPAGESPQPKAAPEASSPPASPLQH    631 - 700
LLPGKAVDLGPPKPSDQETGEQVSSPSSHPALHTTTEDSAGVQTEF                            701 - 746
//

Text Mined References (31)

PMID Year Title