Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 4.9e-26
group 4 medulloblastoma 1855 1.6e-06
oligodendroglioma 2850 1.5e-02

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.600 1.6e-06
lung carcinoma 2.000 4.9e-26
oligodendroglioma 1.100 1.5e-02

AA Sequence

MWKTWLQGGARVIFDDYKPYLRLDPQNGDLLLNEQLDREALCDLTEPCILHFQVLFENPLQFFRAELLVK      1 - 70
DINDHTPTFLNNHMLLKISEGATLGTLFQIDSAQDLDVGKNGVQNYTISPNPHFHLKLRDSDEGRKYPEL     71 - 140
VLDQSLDREKVSEFSLTLTAVDGGSPPRSGTTLINVVVLDISDNAPEFEKPVYEVLVPESSPLDSLIIKA    141 - 210
SATDLDAGINGELSYSFSHVSRDVRKTFEIHPISGEVYLKAPLDFEIIQSYIINIQAIEGGSLSGKSSIL    211 - 280
VRVVDVNDNPPEIAMTSLTSPIPENSSPEMVVAVFSIRDQDAGDNGRTVCSIQDNLPFVLKPTFKNFYAL    281 - 350
VTEHPLDREVRNEYNITITVTDLGTPRLKTEHNITVLVSDVNDNAPIFTQTSYTLFVRENNSPALHIGSV    351 - 420
SATDRDSGTNAQVTYSLLPPQDPHLPLTSLVSINADNGHLFALRSLDYEALQEFGFRVGAADHGSPALSS    421 - 490
EVLVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPG    491 - 560
LFGVWAHNGEGRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVEGFSQPYLPLTEAAPSQAQA    561 - 630
DSLTVYLVVALASVSSLFLFSVFLFVAVRLCRRSRAASMGRCSVPECPFPGHLVDVSGTGTLSQSYQYEV    631 - 700
CLTGGSGANEFKFLKPVIPNLLSRDSEMEKAPPF                                        701 - 734
//

Text Mined References (8)

PMID Year Title