Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

AA Sequence

MWKTWLQGGARVIFDDYKPYLRLDPQNGDLLLNEQLDREALCDLTEPCILHFQVLFENPLQFFRAELLVK      1 - 70
DINDHTPTFLNNHMLLKISEGATLGTLFQIDSAQDLDVGKNGVQNYTISPNPHFHLKLRDSDEGRKYPEL     71 - 140
VLDQSLDREKVSEFSLTLTAVDGGSPPRSGTTLINVVVLDISDNAPEFEKPVYEVLVPESSPLDSLIIKA    141 - 210
SATDLDAGINGELSYSFSHVSRDVRKTFEIHPISGEVYLKAPLDFEIIQSYIINIQAIEGGSLSGKSSIL    211 - 280
VRVVDVNDNPPEIAMTSLTSPIPENSSPEMVVAVFSIRDQDAGDNGRTVCSIQDNLPFVLKPTFKNFYAL    281 - 350
VTEHPLDREVRNEYNITITVTDLGTPRLKTEHNITVLVSDVNDNAPIFTQTSYTLFVRENNSPALHIGSV    351 - 420
SATDRDSGTNAQVTYSLLPPQDPHLPLTSLVSINADNGHLFALRSLDYEALQEFGFRVGAADHGSPALSS    421 - 490
EVLVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPG    491 - 560
LFGVWAHNGEGRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVEGFSQPYLPLTEAAPSQAQA    561 - 630
DSLTVYLVVALASVSSLFLFSVFLFVAVRLCRRSRAASMGRCSVPECPFPGHLVDVSGTGTLSQSYQYEV    631 - 700
CLTGGSGANEFKFLKPVIPNLLSRDSEMEKAPPF                                        701 - 734
//

Text Mined References (8)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11322959 2001 The human and murine protocadherin-beta one-exon gene families show high evolutionary conservation, despite the difference in gene number.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
10380929 1999 A striking organization of a large family of human neural cadherin-like cell adhesion genes.