Property Summary

NCBI Gene PubMed Count 4
PubMed Score 36.62
PubTator Score 10.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 3.1e-13
glioblastoma 5792 1.6e-06
Astrocytoma, Pilocytic 3081 2.4e-04
pediatric high grade glioma 1064 3.1e-04
group 3 medulloblastoma 4104 4.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.325 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 2.4e-04
ependymoma -1.500 3.1e-13
glioblastoma -1.300 1.6e-06
group 3 medulloblastoma 2.000 4.9e-04
pediatric high grade glioma -1.100 3.1e-04

Gene RIF (2)

AA Sequence

MPRGFLVKRTKRTGGLYRVRLAERVFPLLGPQGAPPFLEEAPSASLPGAERATPPTREEPGKGLTAEAAR      1 - 70
EQSGSPCRAAGVSPGTGGREGAEWRAGGREGPGPSPSPSPSPAKPAGAELRRAFLERCLSSPVSAESFPG     71 - 140
GAAAVAAFSCSVAPAAAPTPGEQFLLPLRAPFPEPALQPDPAPLSAALQSLKRAAGGERRGKAPTDCASG    141 - 210
PAAAGIKKPKAMRKLSFADEVTTSPVLGLKIKEEEPGAPSRGLGGSRTPLGEFICQLCKEQYADPFALAQ    211 - 280
HRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPAAANAATVSSADGKPPSSSSSSSRDSGAIASFL    281 - 350
AEGKENSRIERTADQHPQARDSSGADQHPDSAPRQGLQVLTHPEPPLPQGPYTEGVLGRRVPVPGSTSGG    351 - 420
RGSEIFVCPYCHKKFRRQAYLRKHLSTHEAGSARALAPGFGSERGAPLAFACPLCGAHFPTADIREKHRL    421 - 490
WHAVREELLLPALAGAPPETSGPSGPSDGSAQQIFSCKHCPSTFFSSPGLTRHINKCHPSESRQVLLLQM    491 - 560
PLRPGC                                                                    561 - 566
//

Text Mined References (7)

PMID Year Title