Property Summary

NCBI Gene PubMed Count 4
Grant Count 6
R01 Count 4
Funding $485,072.5
PubMed Score 34.21
PubTator Score 10.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group A ependymoma -1.700 0.000
glioblastoma -1.300 0.000
group 4 medulloblastoma 3.000 0.000
pediatric high grade glioma -1.100 0.000
pilocytic astrocytoma -1.400 0.000

Gene RIF (2)

PMID Text
21343251 Data show that INSM2 is the expressed n fetal pancreas.
20091020 insulinoma-associated protein 2 beta (IA-2beta) and zinc transporter-8 may have a role in rapid progression of type 1 diabetes

AA Sequence

MPRGFLVKRTKRTGGLYRVRLAERVFPLLGPQGAPPFLEEAPSASLPGAERATPPTREEPGKGLTAEAAR      1 - 70
EQSGSPCRAAGVSPGTGGREGAEWRAGGREGPGPSPSPSPSPAKPAGAELRRAFLERCLSSPVSAESFPG     71 - 140
GAAAVAAFSCSVAPAAAPTPGEQFLLPLRAPFPEPALQPDPAPLSAALQSLKRAAGGERRGKAPTDCASG    141 - 210
PAAAGIKKPKAMRKLSFADEVTTSPVLGLKIKEEEPGAPSRGLGGSRTPLGEFICQLCKEQYADPFALAQ    211 - 280
HRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPAAANAATVSSADGKPPSSSSSSSRDSGAIASFL    281 - 350
AEGKENSRIERTADQHPQARDSSGADQHPDSAPRQGLQVLTHPEPPLPQGPYTEGVLGRRVPVPGSTSGG    351 - 420
RGSEIFVCPYCHKKFRRQAYLRKHLSTHEAGSARALAPGFGSERGAPLAFACPLCGAHFPTADIREKHRL    421 - 490
WHAVREELLLPALAGAPPETSGPSGPSDGSAQQIFSCKHCPSTFFSSPGLTRHINKCHPSESRQVLLLQM    491 - 560
PLRPGC                                                                    561 - 566
//

Text Mined References (7)

PMID Year Title
21343251 2011 Expression of insulinoma-associated 2 (INSM2) in pancreatic islet cells is regulated by the transcription factors Ngn3 and NeuroD1.
20091020 2010 Predictive power of screening for antibodies against insulinoma-associated protein 2 beta (IA-2beta) and zinc transporter-8 to select first-degree relatives of type 1 diabetic patients with risk of rapid progression to clinical onset of the disease: implications for prevention trials.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.