Property Summary

NCBI Gene PubMed Count 116
PubMed Score 0.00
PubTator Score 132.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count P-value
breast carcinoma 1614 4.6373544442328E-56
non-small cell lung cancer 2798 1.81647306233847E-40
psoriasis 6685 1.17368358975663E-36
astrocytoma 1493 1.30621345877654E-27
posterior fossa group B ependymoma 1530 1.31053331705351E-16
glioblastoma 5572 7.41061650849213E-12
lung adenocarcinoma 2714 1.06810761190936E-9
atypical teratoid/rhabdoid tumor 1095 1.36799104904135E-9
pediatric high grade glioma 2712 2.58133609192746E-9
pilocytic astrocytoma 3086 3.76319869887002E-8
group 3 medulloblastoma 2254 1.81125461085483E-7
Atopic dermatitis 944 7.38274023992695E-7
primitive neuroectodermal tumor 3031 8.50802320290351E-7
ovarian cancer 8492 2.00925187242691E-6
medulloblastoma, large-cell 6234 4.41398563317083E-6
invasive ductal carcinoma 2950 6.06765699375623E-5
tuberculosis 1563 6.11098356234548E-5
nasopharyngeal carcinoma 1056 9.53912319850277E-5
ductal carcinoma in situ 1745 1.54269901255184E-4
pancreatic cancer 2300 3.7099796051334E-4
primary Sjogren syndrome 789 0.00186215502752507
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00202812054160422
interstitial cystitis 2299 0.00351999764663467
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00353188001385522
oligodendroglioma 2849 0.00366447374720137
adrenocortical carcinoma 1427 0.0060641211419319
Endometriosis 535 0.0188405264978712
Breast cancer 3099 0.0417668355889055

Synonym

Accession Q96T88 A0JBR2 A8K024 B2RBA9 Q2HIX7 Q8J022 Q9H6S6 Q9P115 Q9P1U7
Symbols Np95
hNP95
ICBP90
RNF106
TDRD22
hUHRF1
huNp95

Gene

PANTHER Protein Class (2)

PDB

2FAZ   2L3R   2LGG   2LGK   2LGL   2PB7   3ASK   3ASL   3BI7   3CLZ   3DB3   3DB4   3DWH   3FL2   3SHB   3SOU   3SOW   3SOX   3T6R   3ZVY   3ZVZ   4GY5   4QQD   5C6D   5IAY  

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 Compartment GO Term (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
687016 screening 2779 / 0 / 367497 Counterscreen for inhibitors of 5-meCpG-binding domain protein 2 (MBD2): TRFRET-based biochemical primary high throughput screening assay to identify inhibitors of binding of ubiquitin-like with PHD and ring finger domains 1 (UHRF1) to methylated oligonucleotide
720530 screening 256 / 0 / 780 Counterscreen for inhibitors of 5-meCpG-binding domain protein 2 (MBD2): TRFRET-based biochemical high throughput screening assay to identify inhibitors of binding of ubiquitin-like with PHD and ring finger domains 1 (UHRF1) to methylated oligonucleotide
720644 confirmatory 4 / 0 / 42 Counterscreen for inhibitors of 5-meCpG-binding domain protein 2 (MBD2): TRFRET-based biochemical high throughput dose response assay to identify inhibitors of binding of ubiquitin-like with PHD and ring finger domains 1 (UHRF1) to methylated oligonucleotide

Gene RIF (98)

PMID Text
27045799 Hemi-methylated DNA opens a closed conformation of UHRF1 to facilitate its H3 histone recognition.
26884069 Results showed that UHRF1 was overexpressed in almost all of the prostate cancer cell (PCa) lines. Its expression levels were correlated with some clinical features of PCa suggesting it as an independent prognostic factor for biochemical recurrence.
26768845 results suggest that UPAT and UHRF1 may be promising molecular targets for the therapy of colon cancer
26752645 These findings identify ICBP90 as a key regulator of MIF transcription and provide functional insight into the regulation of the polymorphic MIF locus.
26727879 This study showed that UHRF1 interacts directly with BRCA1 and is involved in DNA double-strand break repair.
26700964 Studies indicate that ubiquitin like with PHD and ring finger domains 1 protein (UHRF1) interacts with DNA interstrand crosslinks (ICLs) both in vitro and in vivo.
26597461 UHRF1 could form a complex with PRMT5 to contribute to the endometrial carcinogenesis.
26548607 UHRF1 promotes osteosarcoma cell invasion by downregulating the expression of Ecadherin and increasing epithelialtomesenchymal transition in an Rb1dependent manner.
26497117 K-Ras drives UHRF1 expression, establishing a novel link between this oncogene and Nrf2-mediated cellular protection.
26464697 UHRF1 was over-expressed in hepatocellular carcinoma tissues compared to the adjacent normal tissues and UHRF1 expression shared significant relevance with distant metastasis, cancer area and HBV.
More...

AA Sequence

MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQ      1 - 70
LLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEY     71 - 140
VDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARART    141 - 210
IIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKI    211 - 280
ERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLS    281 - 350
SVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP    351 - 420
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNK    421 - 490
RTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYK    491 - 560
VVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEE    561 - 630
EQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLAS    631 - 700
LKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSY    701 - 770
AMQVNQPLQTVLNQLFPGYGNGR                                                   771 - 793
//

Text Mined References (131)

PMID Year Title
27045799 2016 Hemi-methylated DNA opens a closed conformation of UHRF1 to facilitate its histone recognition.
26884069 2016 UHRF1 overexpression is involved in cell proliferation and biochemical recurrence in prostate cancer after radical prostatectomy.
26768845 2016 Long noncoding RNA UPAT promotes colon tumorigenesis by inhibiting degradation of UHRF1.
26752645 2016 Transcription factor ICBP90 regulates the MIF promoter and immune susceptibility locus.
26727879 2016 A cell cycle-dependent BRCA1-UHRF1 cascade regulates DNA double-strand break repair pathway choice.
26700964 2016 UHRF1 is a sensor for DNA interstrand crosslinks.
26597461 2016 Methylation of tumor suppressor gene CDH13 and SHP1 promoters and their epigenetic regulation by the UHRF1/PRMT5 complex in endometrial carcinoma.
26548607 2016 UHRF1 promotes human osteosarcoma cell invasion by downregulating the expression of E?cadherin in an Rb1?dependent manner.
26497117 2016 UHRF1 regulation of the Keap1-Nrf2 pathway in pancreatic cancer contributes to oncogenesis.
26464697 2015 Elevated expression of UHRF1 predicts unfavorable prognosis for patients with hepatocellular carcinoma.
More...