Property Summary

NCBI Gene PubMed Count 129
PubMed Score 0.00
PubTator Score 132.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma 1.685 6.1e-03
adult high grade glioma 3.200 1.7e-05
astrocytic glioma 2.400 9.2e-03
Astrocytoma, Pilocytic 2.800 3.2e-08
Atopic dermatitis 2.000 7.4e-07
atypical teratoid / rhabdoid tumor 3.300 7.1e-07
Breast cancer 3.500 4.2e-02
breast carcinoma 2.100 1.6e-06
ductal carcinoma in situ 2.900 1.5e-04
Endometriosis 2.040 1.9e-02
ependymoma 3.000 2.9e-03
glioblastoma 3.700 7.4e-12
group 3 medulloblastoma 4.400 1.8e-07
interstitial cystitis 1.600 3.5e-03
intraductal papillary-mucinous carcinoma... 2.400 3.5e-03
intraductal papillary-mucinous neoplasm ... 3.500 2.0e-03
invasive ductal carcinoma 3.300 6.1e-05
lung adenocarcinoma 2.000 1.1e-09
medulloblastoma, large-cell 3.900 4.4e-06
nasopharyngeal carcinoma 1.300 9.5e-05
non-small cell lung cancer 3.508 1.8e-40
oligodendroglioma 3.100 3.7e-03
ovarian cancer 1.900 2.0e-06
pancreatic cancer 1.100 3.7e-04
primary Sjogren syndrome 1.500 1.9e-03
primitive neuroectodermal tumor 3.800 8.5e-07
psoriasis 1.600 1.2e-36
tuberculosis 1.700 6.1e-05

 Compartment GO Term (1)

 GWAS Trait (1)

Protein-protein Interaction (1)

PDB (25)

Gene RIF (111)

AA Sequence

MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQ      1 - 70
LLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEY     71 - 140
VDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARART    141 - 210
IIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKI    211 - 280
ERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLS    281 - 350
SVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP    351 - 420
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNK    421 - 490
RTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYK    491 - 560
VVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEE    561 - 630
EQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLAS    631 - 700
LKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSY    701 - 770
AMQVNQPLQTVLNQLFPGYGNGR                                                   771 - 793
//

Text Mined References (145)

PMID Year Title