Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.93
PubTator Score 10.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.547 1.6e-02
active ulcerative colitis 2.385 1.9e-03
adult high grade glioma -1.200 2.5e-04
aldosterone-producing adenoma -1.568 9.3e-03
Alzheimer's disease -1.100 3.5e-02
astrocytic glioma -1.300 4.4e-02
Astrocytoma, Pilocytic 1.600 9.0e-05
atypical teratoid / rhabdoid tumor -1.200 6.2e-03
Breast cancer -1.200 1.8e-07
ductal carcinoma in situ 1.600 1.6e-02
ependymoma -1.400 1.6e-06
glioblastoma -1.100 4.7e-03
group 3 medulloblastoma -1.400 3.4e-02
Hydrolethalus syndrome 1.407 4.8e-02
intraductal papillary-mucinous adenoma (... 1.300 4.0e-03
malignant mesothelioma -1.700 5.1e-05
medulloblastoma, large-cell -1.100 2.2e-02
nasopharyngeal carcinoma 1.400 3.3e-04
osteosarcoma -1.143 5.2e-05
Pick disease -1.600 1.1e-04
primitive neuroectodermal tumor -1.100 2.0e-02
subependymal giant cell astrocytoma -2.055 2.8e-02
tuberculosis and treatment for 6 months 1.200 5.2e-05

Gene RIF (8)

AA Sequence

MEPGDAARPGSGRATGAPPPRLLLLPLLLGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQD      1 - 70
SVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGTPATSGRDKSLSCTQEDRAFS     71 - 140
TLLVNVSGKFFEYTLKGEISPGKINSVEQNDMLRKVTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGS    141 - 210
ILAYAFLGTAVSCFIIGNLMYGVVKLMKIMGQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDL    211 - 280
YALLFGESVLNDAVAIVLSSSIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVNANVTKF    281 - 350
TKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRTKQLFEVLHFLA    351 - 420
ENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNFQHMMMFSGLRG    421 - 490
AMAFALAIRDTASYARQMMFTTTLLIVFFTVWIIGGGTTPMLSWLNIRVGVEEPSEEDQNEHHWQYFRVG    491 - 560
VDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRLWYSFDHNYLKPILTHSGPPLTTTLPAWCGL    561 - 630
LARCLTSPQVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGSSSSHTASTSLEGSRRTKSSSEEVLE    631 - 700
RDLGMGDQKVSSRGTRLVFPLEDNA                                                 701 - 725
//

Text Mined References (12)

PMID Year Title