Property Summary

NCBI Gene PubMed Count 9
PubMed Score 36.21
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 2.400 3.9e-02
medulloblastoma, large-cell 3.800 1.7e-04

Gene RIF (1)

AA Sequence

MKEPGPNFVTVRKGLHSFKMAFVKHLLLFLSPRLECSGSITDHCSLHLPVQEILMSQPPEQLGLQTNLGN      1 - 70
QESSGMMKLFMPRPKVLAQYESIQFMP                                                71 - 97
//

Text Mined References (10)

PMID Year Title