Property Summary

NCBI Gene PubMed Count 9
PubMed Score 37.21
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96T75 Q8N3X0 Q8NDY5 Q96B46
Symbols MMA1
MMA-1
MTAG2
MMA-1a
MMA-1b
CT25.1a
CT25.1b
C21orf65

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
15472897 MMA1 and also MMA1C, -1D, and -1E are members of the cancer-testis antigen family.

AA Sequence

MKEPGPNFVTVRKGLHSFKMAFVKHLLLFLSPRLECSGSITDHCSLHLPVQEILMSQPPEQLGLQTNLGN      1 - 70
QESSGMMKLFMPRPKVLAQYESIQFMP                                                71 - 97
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15472897 2005 The MMA1 gene family of cancer-testis antigens has multiple alternative splice variants: characterization of their expression profile, the genomic organization, and transcript properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213769 2002 Comparative genomic sequence analysis of the human chromosome 21 Down syndrome critical region.
12036297 2002 Nineteen additional unpredicted transcripts from human chromosome 21.
11920614 2002 Expression profiling of MMA-1a and splice variant MMA-1b: new cancer/testis antigens identified in human melanoma.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10830953 2000 The DNA sequence of human chromosome 21.
9503011 1998 Transcriptional map of the 2.5-Mb CBR-ERG region of chromosome 21 involved in Down syndrome.