Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.84
PubTator Score 5.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.60138705939075E-9
osteosarcoma 7933 4.80800526076912E-9
pituitary cancer 1972 4.54914596323727E-5
hepatocellular carcinoma 550 1.60903836150338E-4
medulloblastoma, large-cell 6234 3.59520513142149E-4
gastric cancer 436 0.0021469556436849
subependymal giant cell astrocytoma 2287 0.0330888965563884

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer -1.600 0.002
hepatocellular carcinoma -1.400 0.000
osteosarcoma -3.330 0.000
medulloblastoma, large-cell -1.100 0.000
subependymal giant cell astrocytoma 1.313 0.033
ovarian cancer -1.500 0.000
pituitary cancer 1.300 0.000

Synonym

Accession Q96T68 Q5TC65 Q5TC66 Q5W0A7 Q659A7 Q86UD6 Q96AI6
Symbols CLLD8
CLLL8
KMT1F
C13orf4

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

PMID Text
26709698 these findings identify Setdb2 as a novel regulator of the immune system in acute respiratory viral infection.
26378653 Results indicate that the IgE-associated AT/G polymorphism (rs386770867) regulates transcription of SETDB2.
20404330 Results provide evidence that CLLD8/KMT1F is recruited to heterochromatin regions and contributes in vivo to the deposition of trimethyl marks in concert with SUV39H1/KMT1A.SUV39H1/KMT1A.
20085599 Observational study of gene-disease association. (HuGE Navigator)
18498648 HIV-1 Tat associates with SETDB2 in vitro

AA Sequence

MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEATIINSSTSIKG      1 - 70
ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTENKEILSLEDKVVDFREKDSSSNL     71 - 140
SYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNVEEVFRYLL    141 - 210
ETECNFLFTDNFSFNTYVQLARNYPKQKEVVSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAY    211 - 280
NLTNFSSMFTDSCDCSEGCIDITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCK    281 - 350
CNRQLCQNRVVQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSYGIDENGRDEN    351 - 420
TMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTEKCPPKFSNNPKELTVETKYDNISRIQYHSVIR    421 - 490
DPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFEDNLLIESDVID    491 - 560
ITKYREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGRSTACQRQQVFCDEELLSETKNTSSDSLTKF    561 - 630
NKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTV    631 - 700
PEKEIFCQCGVNKCRKKIL                                                       701 - 719
//

Text Mined References (13)

PMID Year Title
26709698 2015 Type I Interferon Induced Epigenetic Regulation of Macrophages Suppresses Innate and Adaptive Immunity in Acute Respiratory Viral Infection.
26572639 2016 Left-Right Axis Differentiation and Functional Lateralization: a Haplotype in the Methyltransferase Encoding Gene SETDB2 Might Mediate Handedness in Healthy Adults.
26378653 2015 A functional AT/G polymorphism in the 5'-untranslated region of SETDB2 in the IgE locus on human chromosome 13q14.
25416956 2014 A proteome-scale map of the human interactome network.
20404330 2010 CLLD8/KMT1F is a lysine methyltransferase that is important for chromosome segregation.
20085599 2009 A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
More...