Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.82
PubTator Score 5.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer -1.600 2.1e-03
hepatocellular carcinoma -1.400 1.6e-04
medulloblastoma, large-cell -1.100 3.6e-04
osteosarcoma -3.330 4.8e-09
ovarian cancer -1.200 4.1e-06
pituitary cancer 1.300 4.5e-05
subependymal giant cell astrocytoma 1.313 3.3e-02

 IMPC Phenotype (1)

Protein-protein Interaction (10)

Gene RIF (6)

AA Sequence

MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEATIINSSTSIKG      1 - 70
ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTENKEILSLEDKVVDFREKDSSSNL     71 - 140
SYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNVEEVFRYLL    141 - 210
ETECNFLFTDNFSFNTYVQLARNYPKQKEVVSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAY    211 - 280
NLTNFSSMFTDSCDCSEGCIDITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCK    281 - 350
CNRQLCQNRVVQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSYGIDENGRDEN    351 - 420
TMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTEKCPPKFSNNPKELTVETKYDNISRIQYHSVIR    421 - 490
DPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFEDNLLIESDVID    491 - 560
ITKYREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGRSTACQRQQVFCDEELLSETKNTSSDSLTKF    561 - 630
NKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTV    631 - 700
PEKEIFCQCGVNKCRKKIL                                                       701 - 719
//

Text Mined References (13)

PMID Year Title