Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.20
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MFSCCFPTSRGCCFRNGGSESLFRRCRRRLIPHPRRLSPVVIRRIQVPQDSLGQALAGQATPEIPLGLQL      1 - 70
HTVLVQEIQELIEAQTLAPGPCAEVRALPAPAAEPEPAWEEAPPERALELEGAPAKDQTNEELPEITEVP     71 - 140
ESIKRRLGRRVPAATPAPRGNLLLQAWMRVHSWASRLFAPNVLPGTGP                          141 - 188
//

Text Mined References (3)

PMID Year Title