Property Summary

NCBI Gene PubMed Count 17
Grant Count 92
R01 Count 10
Funding $39,108,485.66
PubMed Score 47.42
PubTator Score 38.62

Knowledge Summary

Patent (906)

Expression

  Differential Expression (6)

Synonym

Accession Q96T54 E9PB46 Q5TCF4 Q8TAW4 Q9BXD1 Q9H592
Symbols TALK2
TASK4
TALK-2
TASK-4
K2p17.1

Gene

Gene RIF (5)

PMID Text
25179130 The T carrier of an single-nucleotide polymorphism is associated with reduced risk of cerebral hemorrhage in the Chinese population.
24972929 This study demonstrates that Gly88 is a crucial residue for normal TASK-4 gating behavior and that the channel is strongly expressed in the cardiac conduction system.
23391755 The rs10947803 SNP (A allele) in KCNK17 increases the risk of cerebral hemorrhage but not ischemic stroke in the Chinese population.
19910543 Observational study of gene-disease association. (HuGE Navigator)
19647252 The A allele of the rs10947803 variant of KCNK17 was associated with increased risk of IS and increased levels of KCNK17 gene expression.

AA Sequence

MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLD      1 - 70
RPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVG     71 - 140
IPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTE    141 - 210
GFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHS    211 - 280
SKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS                      281 - 332
//

Text Mined References (17)

PMID Year Title
25179130 2014 Association of variants in KCNK17 gene with ischemic stroke and cerebral hemorrhage in a Chinese population.
24972929 2014 Gain-of-function mutation in TASK-4 channels and severe cardiac conduction disorder.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23391755 2013 The rs10947803 SNP of KCNK17 is associated with cerebral hemorrhage but not ischemic stroke in a Chinese population.
22158537 2011 Meta-analysis of genome-wide association studies identifies eight new loci for type 2 diabetes in east Asians.
19910543 2010 Confirmation of genomewide association signals in Chinese Han population reveals risk loci for ischemic stroke.
19647252 2010 KCNK17 genetic variants in ischemic stroke.
18516069 2008 Regulation of two-pore-domain (K2P) potassium leak channels by the tyrosine kinase inhibitor genistein.
16382106 2005 International Union of Pharmacology. LV. Nomenclature and molecular relationships of two-P potassium channels.
More...