Property Summary

NCBI Gene PubMed Count 18
PubMed Score 49.98
PubTator Score 38.62

Knowledge Summary

Patent (906)

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... -1.100 2.6e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.0e-03
lung adenocarcinoma -1.100 1.6e-03
medulloblastoma, large-cell 1.300 2.2e-05
osteosarcoma -1.220 4.1e-02
psoriasis 2.100 1.3e-15

Gene RIF (6)

AA Sequence

MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLD      1 - 70
RPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVG     71 - 140
IPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTE    141 - 210
GFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHS    211 - 280
SKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS                      281 - 332
//

Text Mined References (18)

PMID Year Title