Property Summary

NCBI Gene PubMed Count 13
Grant Count 13
R01 Count 6
Funding $1,353,455
PubMed Score 32.40
PubTator Score 8.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (14)

PMID Text
25562443 The GOAT active site was characterized by defining substrate-enzyme interactions used to bind and recognize ghrelin.
24194510 Studies suggest that dysregulation in the components of the ghrelin system including ghrelin, ghrelin receptor (GHSR1a) and ghrelin-O-acyl-transferase can lead to or influence the development and/or progression of highly concerning pathologies.
24045953 Architectural organization of the metabolic regulatory enzyme ghrelin O-acyltransferase.
23879975 Data indicate that ghrelin O-acyltransferase (GOAT) mRNA and protein are expressed in the normal prostate and prostate cancer tissue samples.
23454172 GOAT is also present in human plasma and GOAT protein levels depend on the metabolic environment with decreased levels in anorexic and increased levels in morbidly obese patients
22869322 Visceral adipose tissue from obese patients with type 2 diabetes showed higher levels of GOAT.
21930173 Genetic variation of the ghrelin activator gene ghrelin O-acyltransferase (GOAT) is associated with anorexia nervosa. (Review)
21646729 Identification of GOAT expression in various tissues support the concept that in addition to the important endocrine effect of acylated ghrelin, the paracrine effects of locally synthetised and acylated ghrelin may be important.
21150588 Modulation of GOAT or ghrelin signaling may be a clinically relevant strategy to treat metabolic diseases such as type II diabetes.
21035823 Based on the results of tjhis study concluded that genetic variation in GOAT might be implicated in the etiology of anorexia nervosa.
More...

AA Sequence

MEWLWLFFLHPISFYQGAAFPFALLFNYLCIMDSFSTRARYLFLLTGGGALAVAAMGSYAVLVFTPAVCA      1 - 70
VALLCSLAPQQVHRWTFCFQMSWQTLCHLGLHYTEYYLHEPPSVRFCITLSSLMLLTQRVTSLSLDICEG     71 - 140
KVKAASGGFRSRSSLSEHVCKALPYFSYLLFFPALLGGSLCSFQRFQARVQGSSALHPRHSFWALSWRGL    141 - 210
QILGLECLNVAVSRVVDAGAGLTDCQQFECIYVVWTTAGLFKLTYYSHWILDDSLLHAAGFGPELGQSPG    211 - 280
EEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHSRAWPLLQTFAFSAWWHGLHPGQVFGFVC    281 - 350
WAVMVEADYLIHSFANEFIRSWPMRLFYRTLTWAHTQLIIAYIMLAVEVRSLSSLWLLCNSYNSVFPMVY    351 - 420
CILLLLLAKRKHKCN                                                           421 - 435
//

Text Mined References (14)

PMID Year Title
25562443 2015 Structure-activity analysis of human ghrelin O-acyltransferase reveals chemical determinants of ghrelin selectivity and acyl group recognition.
24194510 2014 Ghrelin gene products, receptors, and GOAT enzyme: biological and pathophysiological insight.
24045953 2013 Architectural organization of the metabolic regulatory enzyme ghrelin O-acyltransferase.
23879975 2013 Ghrelin O-acyltransferase (GOAT) is expressed in prostate cancer tissues and cell lines and expression is differentially regulated in vitro by ghrelin.
23454172 2013 The ghrelin activating enzyme ghrelin-O-acyltransferase (GOAT) is present in human plasma and expressed dependent on body mass index.
22869322 2012 The ghrelin O-acyltransferase-ghrelin system reduces TNF-?-induced apoptosis and autophagy in human visceral adipocytes.
21930173 2011 Genetic studies on the ghrelin, growth hormone secretagogue receptor (GHSR) and ghrelin O-acyl transferase (GOAT) genes.
21646729 2011 The expression of ghrelin O-acyltransferase (GOAT) in human tissues.
21150588 2011 The ghrelin O-acyltransferase-ghrelin system: a novel regulator of glucose metabolism.
21035823 2011 Genetic variation of the ghrelin activator gene ghrelin O-acyltransferase (GOAT) is associated with anorexia nervosa.
More...