Property Summary

NCBI Gene PubMed Count 16
PubMed Score 34.21
PubTator Score 8.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (17)

AA Sequence

MEWLWLFFLHPISFYQGAAFPFALLFNYLCIMDSFSTRARYLFLLTGGGALAVAAMGSYAVLVFTPAVCA      1 - 70
VALLCSLAPQQVHRWTFCFQMSWQTLCHLGLHYTEYYLHEPPSVRFCITLSSLMLLTQRVTSLSLDICEG     71 - 140
KVKAASGGFRSRSSLSEHVCKALPYFSYLLFFPALLGGSLCSFQRFQARVQGSSALHPRHSFWALSWRGL    141 - 210
QILGLECLNVAVSRVVDAGAGLTDCQQFECIYVVWTTAGLFKLTYYSHWILDDSLLHAAGFGPELGQSPG    211 - 280
EEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHSRAWPLLQTFAFSAWWHGLHPGQVFGFVC    281 - 350
WAVMVEADYLIHSFANEFIRSWPMRLFYRTLTWAHTQLIIAYIMLAVEVRSLSSLWLLCNSYNSVFPMVY    351 - 420
CILLLLLAKRKHKCN                                                           421 - 435
//

Text Mined References (17)

PMID Year Title