Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.82
PubTator Score 11.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Autistic Disorder 364 3.786 1.9
Disease Target Count P-value
Breast cancer 3578 1.8e-10
psoriasis 6694 2.3e-09
tuberculosis 2010 1.0e-05
acute myeloid leukemia 783 6.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.4
Disease Target Count Z-score Confidence
Gilles de la Tourette syndrome 47 5.559 2.8
Atypical autism 26 3.137 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -1.100 6.0e-03
Breast cancer -1.300 1.8e-10
psoriasis -1.300 2.3e-09
tuberculosis 1.200 1.0e-05

Pathway (1)

Gene RIF (13)

AA Sequence

MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFE      1 - 70
VHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWVEGDHHGHSFDSNSFGPVSLG     71 - 140
LLHAHATHILWPPERWQKLESVLPPERLPVQREEE                                       141 - 175
//

Text Mined References (24)

PMID Year Title