Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.19
PubTator Score 9.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
ependymoma 2514 2.25284412963476E-28
non-small cell lung cancer 2798 2.73271911175771E-16
oligodendroglioma 2849 1.61290787203626E-15
atypical teratoid / rhabdoid tumor 4369 4.06781197803897E-14
group 4 medulloblastoma 1875 1.8757894455493E-11
pediatric high grade glioma 2712 5.03269758115286E-11
glioblastoma 5572 7.16636108404353E-9
primitive neuroectodermal tumor 3031 1.2910152025974E-7
pilocytic astrocytoma 3086 5.56660902530306E-5
osteosarcoma 7933 1.04871036678817E-4
tuberculosis 1563 1.42820012423397E-4
medulloblastoma, large-cell 6234 2.67464748866776E-4
lung cancer 4473 4.4090145459357E-4
interstitial cystitis 2299 5.40779938960058E-4
ulcerative colitis 2087 0.00121007621948336
astrocytoma 1493 0.00147438526940857
primary Sjogren syndrome 789 0.00155863856200658
subependymal giant cell astrocytoma 2287 0.00194087494709558
invasive ductal carcinoma 2950 0.0112581895258639
cutaneous lupus erythematosus 1056 0.0338105119432378
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -2.900 0.001
ependymoma -4.500 0.000
oligodendroglioma -2.300 0.000
cutaneous lupus erythematosus 1.200 0.034
glioblastoma -4.500 0.000
osteosarcoma -2.416 0.000
group 4 medulloblastoma -4.900 0.000
atypical teratoid / rhabdoid tumor -5.000 0.000
medulloblastoma, large-cell -4.300 0.000
primitive neuroectodermal tumor -3.700 0.000
tuberculosis -1.100 0.000
non-small cell lung cancer -1.462 0.000
lung cancer -1.500 0.000
interstitial cystitis 2.300 0.001
pediatric high grade glioma -4.000 0.000
pilocytic astrocytoma -2.200 0.000
primary Sjogren syndrome 1.600 0.002
subependymal giant cell astrocytoma -3.581 0.002
invasive ductal carcinoma -1.400 0.011
ulcerative colitis 1.700 0.001

Synonym

Accession Q96T49 A2RRR6 E9PFS8 O94912 Q5W9G4 Q9NQG4
Symbols TIMAP
ANKRD4

Gene

  Ortholog (11)

 MGI Term (1)

 GWAS Trait (1)

Pathway (1)

Gene RIF (6)

PMID Text
26497934 ROCK phosphorylated eEF1A1 is a novel substrate for TIMAP-PP1 underlining the complex regulatory role of TIMAP in the endothelium.
25007873 TIMAP promotes angiogenesis by suppressing PTEN-mediated Akt inhibition in human glomerular endothelial cells.
21907835 These data confirmed the barrier-protective role of TIMAP
21466834 Data suggest that double-thiophosphorylation of TIMAP has minor effect on its binding ability to PP1c, but considerably attenuates its inhibitory effect on the activity of PP1c.
18586956 involvement of TIMAP in PKA-mediated moesin dephosphorylation and the importance of this dephosphorylation in TIMAP-mediated endothelial cell barrier protection
12055102 TIMAP, a novel CAAX box protein regulated by TGF-beta1 and expressed in endothelial cells.

AA Sequence

MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEASV      1 - 70
ALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHA     71 - 140
AATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIA    141 - 210
DIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAEL    211 - 280
LVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRAS    281 - 350
LSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPRGEL    351 - 420
DMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTLLELKRQRAAA    421 - 490
KLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFKAPIEEMEEKV    491 - 560
HGCCRIS                                                                   561 - 567
//

Text Mined References (17)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26497934 2015 Elongation factor-1A1 is a novel substrate of the protein phosphatase 1-TIMAP complex.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25007873 2014 TIMAP promotes angiogenesis by suppressing PTEN-mediated Akt inhibition in human glomerular endothelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21907835 2011 TIMAP protects endothelial barrier from LPS-induced vascular leakage and is down-regulated by LPS.
21466834 2011 Characterization of the effect of TIMAP phosphorylation on its interaction with protein phosphatase 1.
18586956 2008 TIMAP is a positive regulator of pulmonary endothelial barrier function.
16263087 2005 The protein phosphatase-1 targeting subunit TIMAP regulates LAMR1 phosphorylation.
More...