Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.82
PubTator Score 9.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.900 4.1e-06
astrocytic glioma -1.800 1.3e-02
Astrocytoma, Pilocytic -1.900 4.9e-05
atypical teratoid / rhabdoid tumor -3.900 1.3e-13
cutaneous lupus erythematosus 1.200 3.4e-02
ependymoma -2.800 9.4e-04
glioblastoma -3.000 2.9e-10
group 3 medulloblastoma -4.000 6.8e-07
interstitial cystitis 2.200 6.8e-04
invasive ductal carcinoma -1.100 1.5e-02
lung cancer -1.500 4.4e-04
medulloblastoma, large-cell -2.900 2.2e-04
non-small cell lung cancer -1.019 5.5e-15
oligodendroglioma -1.300 3.9e-02
osteosarcoma -2.283 2.4e-05
primary Sjogren syndrome 1.300 6.9e-03
primitive neuroectodermal tumor -3.300 1.4e-06
subependymal giant cell astrocytoma -2.826 5.0e-03
tuberculosis -1.100 1.4e-04
ulcerative colitis 1.400 5.4e-03

Gene RIF (9)

AA Sequence

MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSTGGRRKKVSFEASV      1 - 70
ALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHA     71 - 140
AATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRVAPEQQMIA    141 - 210
DIHCMIAAGQDLDWIDAQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAEL    211 - 280
LVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRAS    281 - 350
LSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPRGEL    351 - 420
DMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTLLELKRQRAAA    421 - 490
KLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFKAPIEEMEEKV    491 - 560
HGCCRIS                                                                   561 - 567
//

Text Mined References (21)

PMID Year Title