Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.39
PubTator Score 5.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Craniofacial Abnormalities 151 0.0 0.0
Neural Tube Defects 31 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.4e-03
Disease Target Count Z-score Confidence
Motor neuron disease 49 0.0 0.9

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 1.4e-03

Gene RIF (4)

AA Sequence

MFLKAGRGNKVPPVRVYGPDCVVLMEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRA      1 - 70
AVAHLRLRDLGADPGVATTPLGPEHMAQASTLGLSPPSQAFPAHPEAPAAAARAAALVAHPGAGSYPCGG     71 - 140
GSSGAQPSAPPPPAPPLPPTPSPPPPPPPPPPPALSGYTTTNSGGGGSSGKGHSRDFVLRRDLSATAPAA    141 - 210
AMHGAPLGGEQRSGTGSPQHPAPPPHSAGMFISASGTYAGPDGSGGPALFPALHDTPGAPGGHPHPLNGQ    211 - 280
MRLGLAAAAAAAAAELYGRAEPPFAPRSGDAHYGAVAAAAAAALHGYGAVNLNLNLAAAAAAAAAGPGPH    281 - 350
LQHHAPPPAPPPPPAPAQHPHQHHPHLPGAAGAFLRYMRQPIKQELICKWIDPDELAGLPPPPPPPPPPP    351 - 420
PPPPAGGAKPCSKTFGTMHELVNHVTVEHVGGPEQSSHVCFWEDCPREGKPFKAKYKLINHIRVHTGEKP    421 - 490
FPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKIRGCDK    491 - 560
SYTHPSSLRKHMKIHCKSPPPSPGPLGYSSVGTPVGAPLSPVLDPARSHSSTLSPQVTNLNEWYVCQASG    561 - 630
APSHLHTPSSNGTTSETEDEEIYGNPEVVRTIH                                         631 - 663
//

Text Mined References (18)

PMID Year Title