Property Summary

NCBI Gene PubMed Count 6
Grant Count 7
R01 Count 6
Funding $560,229.67
PubMed Score 7.71
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.001

Gene RIF (2)

PMID Text
20683983 the smallest 13q deletion associated to DWM allows further narrowing of the previously established critical region for this brain malformation to 13q32.2-32.3. Among the few genes of the deleted region, ZIC2 and ZIC5 seem the most plausible candidates.
20199689 ZIC1, ZIC2, and ZIC5 may have roles in meningiomas

AA Sequence

MFLKAGRGNKVPPVRVYGPDCVVLMEPPLSKRNPPALRLADLATAQVQPLQNMTGFPALAGPPAHSQLRA      1 - 70
AVAHLRLRDLGADPGVATTPLGPEHMAQASTLGLSPPSQAFPAHPEAPAAAARAAALVAHPGAGSYPCGG     71 - 140
GSSGAQPSAPPPPAPPLPPTPSPPPPPPPPPPPALSGYTTTNSGGGGSSGKGHSRDFVLRRDLSATAPAA    141 - 210
AMHGAPLGGEQRSGTGSPQHPAPPPHSAGMFISASGTYAGPDGSGGPALFPALHDTPGAPGGHPHPLNGQ    211 - 280
MRLGLAAAAAAAAAELYGRAEPPFAPRSGDAHYGAVAAAAAAALHGYGAVNLNLNLAAAAAAAAAGPGPH    281 - 350
LQHHAPPPAPPPPPAPAQHPHQHHPHLPGAAGAFLRYMRQPIKQELICKWIDPDELAGLPPPPPPPPPPP    351 - 420
PPPPAGGAKPCSKTFGTMHELVNHVTVEHVGGPEQSSHVCFWEDCPREGKPFKAKYKLINHIRVHTGEKP    421 - 490
FPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKIRGCDK    491 - 560
SYTHPSSLRKHMKIHCKSPPPSPGPLGYSSVGTPVGAPLSPVLDPARSHSSTLSPQVTNLNEWYVCQASG    561 - 630
APSHLHTPSSNGTTSETEDEEIYGNPEVVRTIH                                         631 - 663
//

Text Mined References (9)

PMID Year Title
25233373 2014 Genome-wide meta-analysis of myopia and hyperopia provides evidence for replication of 11 loci.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20683983 2010 Description of the smallest critical region for Dandy-Walker malformation in chromosome 13 in a girl with a cryptic deletion related to t(6;13)(q23;q32).
20199689 2010 Expression of ZIC family genes in meningiomas and other brain tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15465018 2004 Molecular properties of Zic4 and Zic5 proteins: functional diversity within Zic family.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
11044622 2000 A new murine zinc finger gene, Opr.