Property Summary

NCBI Gene PubMed Count 40
Grant Count 7
R01 Count 5
Funding $448,865.83
PubMed Score 49.23
PubTator Score 51.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.039
osteosarcoma 1.893 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
pancreatic ductal adenocarcinoma liver m... 1.619 0.031
aldosterone-producing adenoma -1.690 0.007
psoriasis -1.700 0.000
Pick disease 1.500 0.000
ovarian cancer 1.700 0.000
pituitary cancer 1.100 0.000

Gene RIF (30)

PMID Text
26259146 essential centromeric component that recruits PLK1 to kinetochores and plays a crucial role in faithful cell division
25337201 High-expression of Rsf-1 is associated with pathologic subtypes of breast cancer, aggressive phenotype, p53 positive and poor clinical outcome, which confers tumor aggressiveness through chromatin remodeling.
25111480 RSF1 plays a critical role in DNA double stranded break repair, a process in which it acts independently from its binding partner SMARCA5.
24800743 RSF1 facilitates DNA double-strand break repair by recruiting centromeric and Fanconi Anaemia proteins.
24798976 Rsf-1 contributes to hepatocellular carcinoma cell growth through regulation of cell cycle proteins.
24584698 Rsf-1 contributes to prostate cancer cell growth and invasion, which makes it a candidate therapeutic target.
24351651 Chromatin remodeler Rsf-1 is a guard in DNA damage checkpoints and homologous recombination repair.
23974106 Remodeling and spacing factor 1 promotes the assembly of CENP-S and CENP-X at damaged chromatin and regulates DSB repair by homologous recombination and non-homologous end-joining.
23536579 Rsf-1 increases the frequency of abnormal mitotic events by disrupting hBubR1-Cdc20 interactions.
23456648 Serum HBXAP DNA from 65 lung cancer patients and 20 healthy controls was quantified using real-time fluorescent quantitative polymerase chain reaction.
More...

AA Sequence

MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVEL      1 - 70
HLKLMRKIGKSVTADRWEKYLIKICQEFNSTWAWEMEKKGYLEMSVECKLALLKYLCECQFDDNLKFKNI     71 - 140
INEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQID    141 - 210
PVLLKNSSQQDNSSRESPSLEDEETKKEEETPKQEEQKESEKMKSEEQPMDLENRSTANVLEETTVKKEK    211 - 280
EDEKELVKLPVIVKLEKPLPENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPER    281 - 350
IEFGGNIKSSHEITEKSTEETEKLKNDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQ    351 - 420
EEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFYETKEESYSPSKDRNIITEGNGTESL    421 - 490
NSVITSMKTGELEKETAPLRKDADSSISVLEIHSQKAQIEEPDPPEMETSLDSSEMAKDLSSKTALSSTE    491 - 560
SCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDAQRLSPIPEEVPKSTLESEKPGSPEAAETSP    561 - 630
PSNIIDHCEKLASEKEVVECQSTSTVGGQSVKKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGS    631 - 700
MQKSKFKYKLVPEEETTASENTEITSERQKEGIKLTIRISSRKKKPDSPPKVLEPENKQEKTEKEEEKTN    701 - 770
VGRTLRRSPRISRPTAKVAEIRDQKADKKRGEGEDEVEEESTALQKTDKKEILKKSEKDTNSKVSKVKPK    771 - 840
GKVRWTGSRTRGRWKYSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLPNHPELILLCD    841 - 910
SCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLVYVGISIEN    911 - 980
IIPPQEPDFSEDQEEKKKDSKKSKANLLERRSTRTRKCISYRFDEFDEAIDEAIEDDIKEADGGGVGRGK    981 - 1050
DISTITGHRGKDISTILDEERKENKRPQRAAAARRKKRRRLNDLDSDSNLDEEESEDEFKISDGSQDEFV   1051 - 1120
VSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRKTPKKKYSDDDEEEESEENSRDSESD   1121 - 1190
FSDDFSDDFVETRRRRSRRNQKRQINYKEDSESDGSQKSLRRGKEIRRVHKRRLSSSESEESYLSKNSED   1191 - 1260
DELAKESKRSVRKRGRSTDEYSEADEEEEEEEGKPSRKRLHRIETDEEESCDNAHGDANQPARDSQPRVL   1261 - 1330
PSEQESTKKPYRIESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTA   1331 - 1400
SASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL                                1401 - 1441
//

Text Mined References (55)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26259146 2015 The chromatin remodeller RSF1 is essential for PLK1 deposition and function at mitotic kinetochores.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25337201 2014 Overexpression of Rsf-1 correlates with pathological type, p53 status and survival in primary breast cancer.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25111480 2014 Remodeling and spacing factor 1 (RSF1): a rising star in DNA repair.
24800743 2014 The RSF1 histone-remodelling factor facilitates DNA double-strand break repair by recruiting centromeric and Fanconi Anaemia proteins.
24798976 2014 Rsf-1 overexpression serves as a prognostic marker in human hepatocellular carcinoma.
More...