Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -3.200 9.4e-08
astrocytic glioma -3.100 2.9e-03
Astrocytoma, Pilocytic -2.800 5.9e-10
atypical teratoid / rhabdoid tumor -3.200 8.8e-06
ependymoma -3.700 1.8e-03
glioblastoma -2.800 1.4e-08
group 3 medulloblastoma -1.800 9.3e-04
intraductal papillary-mucinous adenoma (... 2.000 4.5e-02
lung carcinoma 3.000 3.1e-41
medulloblastoma, large-cell -2.000 1.2e-03
non-small cell lung cancer 1.402 1.2e-07
oligodendroglioma -2.800 5.7e-03
ovarian cancer 1.100 2.1e-02
Pick disease -1.700 2.3e-02
pituitary cancer 1.800 3.1e-06
primitive neuroectodermal tumor -2.100 4.1e-03
spina bifida -1.044 3.3e-02

AA Sequence

MERGGGGSGTGSRPEGTARGTSLPGKIAEPGAVRTSQPNYRPQGMEGFLKSDERQRLAKERREEREKCLA      1 - 70
AREQQILEKQKRARLQYEKQMEERWRKLEEQRQREDQKRAAVEEKRKQKLREEEERLEAMMRRSLERTQQ     71 - 140
LELKKKYSWGAPLAIGPGGHDACDKLSTSTMSLPKPTEPPMNKRLSSSTVAISYSPDRVFHVCPRLAPLG    141 - 210
PLNPSYKSSPTRNIEKKKATSTSTSGAGDVGKEALSGGEASLVEKVKRGQRTATSLPVVNFGSPLRRCEF    211 - 280
SGGIPKRPSSPVISKTATKAYPQSPKTTKPPYPGSPVKYRLPALSGQDMPKRKAEKEKSNKEREGTLAQQ    281 - 350
AAGPQGEEALEKHVVDKHASEKHAAAAGGKAENSAALGKPTAGTTDAGEAAKILAEKRRQARLQKEQEEQ    351 - 420
ERLEKEEQDRLEREELKRKAEEERLRLEEEARKQEEERKRQEEEKKKQEGEEKRKAGEEAKRKAEEELLL    421 - 490
KEKQEQEKQEKAMIEKQKEAAETKAREVAEQMRLEREQIMLQIEQERLERKKRIDEIMKRTRKSDVSPQV    491 - 560
KKEDPKVGVQPAVCVEKKTKLVVPNKMEINGLNTCQEVNGVDHAAPETYPQDIFSNGLKPAGGLIHLDAL    561 - 630
DGKSNSLDDSTEEVQSMDVSPVSKEELISIPEFSPVSEMIPGVSLDQNGTGNARALQDLLDFTGPPTFPK    631 - 700
RSSENLSLDDCNKNLIEGFNSPGQETPLNTFC                                          701 - 732
//

Text Mined References (9)

PMID Year Title