Property Summary

NCBI Gene PubMed Count 25
PubMed Score 19.02
PubTator Score 108.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.2e-05
lung cancer 4740 3.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Mikulicz disease 3 4.221 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.300 3.8e-03
osteosarcoma -1.354 1.2e-05

Gene RIF (8)

AA Sequence

MHPLQCVLQVQRSLGWGPLASVSWLSLRMCRAHSSLSSTMCPSPERQEDGARKDFSSRLAAGPTFQHFLK      1 - 70
SASAPQEKLSSEVEDPPPYLMMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI     71 - 140
LLVTCSIREKAEQTIWNRLHQLKALKTRRPRSRVPLRIGILGCMAERLKEEILNREKMVDILAGPDAYRD    141 - 210
LPRLLAVAESGQQAANVLLSLDETYADVMPVQTSASATSAFVSIMRGCDNMCSYCIVPFTRGRERSRPIA    211 - 280
SILEEVKKLSEQVFLPPRPPKVLGLQGLKEVTLLGQNVNSFRDNSEVQFNSAVPTNLSRGFTTNYKTKQG    281 - 350
GLRFAHLLDQVSRVDPEMRIRFTSPHPKDFPDEVLQLIHERDNICKQIHLPAQSGSSRVLEAMRRGYSRE    351 - 420
AYVELVHHIRESIPGVSLSSDFIAGFCGETEEDHVQTVSLLREVQYNMGFLFAYSMRQKTRAYHRLKDDV    421 - 490
PEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNP    491 - 560
GLRVRAQPGDYVLVKITSASSQTLRGHVLCRTTLRDSSAYC                                 561 - 601
//

Text Mined References (25)

PMID Year Title