Property Summary

NCBI Gene PubMed Count 10
Grant Count 123
R01 Count 75
Funding $25,901,266.94
PubMed Score 571.19
PubTator Score 9.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
subependymal giant cell astrocytoma -1.414 0.049
ovarian cancer -1.300 0.000

Synonym

Accession Q96SZ5 B1AL29
Symbols C10orf22

Gene

ADO

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
17581819 when endogenous expression of the human ADO ortholog C10orf22 in HepG2/C3A cells was reduced by RNA-mediated interference, hypotaurine production decreased

AA Sequence

MPRDNMASLIQRIARQACLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAP      1 - 70
RKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGG     71 - 140
GQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAP    141 - 210
PYDPDDGRDCHYYRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP              211 - 270
//

Text Mined References (12)

PMID Year Title
25108386 2014 Genome-wide association analysis of Vogt-Koyanagi-Harada syndrome identifies two new susceptibility loci at 1p31.2 and 10q21.3.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22327514 2012 Common variants near TARDBP and EGR2 are associated with susceptibility to Ewing sarcoma.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17581819 2007 Discovery and characterization of a second mammalian thiol dioxygenase, cysteamine dioxygenase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...