Property Summary

NCBI Gene PubMed Count 10
PubMed Score 603.06
PubTator Score 9.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.300 8.5e-05
subependymal giant cell astrocytoma -1.414 4.9e-02

Synonym

Accession Q96SZ5 B1AL29
Symbols C10orf22

Gene

ADO

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MPRDNMASLIQRIARQACLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAP      1 - 70
RKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGG     71 - 140
GQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAP    141 - 210
PYDPDDGRDCHYYRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP              211 - 270
//

Text Mined References (12)

PMID Year Title